KEGG   Nocardia cyriacigeorgica: NOCYR_0085Help
Entry
NOCYR_0085        CDS       T01756                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase, Mn
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ncy  Nocardia cyriacigeorgica
Brite
Enzymes [BR:ncy01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NOCYR_0085 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CCF60909
UniProt: H6R6D6
LinkDB All DBs
Position
complement(94175..94798)
Genome map
AA seq 207 aa AA seqDB search
MAEYTLPDLDYDYSALEPHISGQINELHHSKHHAAYVAGANTALEKLEAAREAGDHSAIF
LHEKNLAFHLGGHVNHSIWWKNLSPNGGDKPVGELAAAIDDQFGSFDKFRAQFTAAANGL
QGSGWAVLGYDTLGQKLLTFQLYDQQANVPLGIIPLLQVDMWEHAFYLQYKNVKADYVTA
FWNVVNWADVQDRFAKAVNQGKGLIFG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagtacacgctgccggatctggattacgactacagcgccctggaaccccacatc
tccgggcagatcaacgagctgcaccattccaagcaccacgccgcctacgtcgccggtgcc
aacacggcactggagaagctggaagccgcccgtgaggccggcgatcacagcgcgatcttc
ctgcacgagaagaacctcgcgttccacctcggcggacacgtcaaccactccatctggtgg
aagaacctgtcccccaacggtggcgacaagccggtcggcgagctggccgcggccatcgac
gaccagttcggttcgttcgacaagttccgcgcgcagttcaccgccgcggccaacggcctg
cagggctcgggctgggcggtgctcggttacgacaccctcggccagaagctgctgaccttc
cagctctacgaccagcaggccaacgtgccgctgggcatcatcccgctgctccaggtcgac
atgtgggagcacgccttctacctgcagtacaagaacgtcaaggccgactacgtgaccgcg
ttctggaacgtcgtcaactgggccgacgtgcaggaccgcttcgcgaaggccgtcaaccag
ggcaagggccttatcttcgggtaa

DBGET integrated database retrieval system