KEGG   Nocardia cyriacigeorgica: NOCYR_0982Help
Entry
NOCYR_0982        CDS       T01756                                 

Gene name
icd
Definition
(GenBank) Isocitrate dehydrogenase (NADP-dependent), (Oxalosuccinate decarboxylase)
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
ncy00020  Citrate cycle (TCA cycle)
ncy00480  Glutathione metabolism
ncy01100  Metabolic pathways
ncy01110  Biosynthesis of secondary metabolites
ncy01120  Microbial metabolism in diverse environments
ncy01130  Biosynthesis of antibiotics
ncy01200  Carbon metabolism
ncy01210  2-Oxocarboxylic acid metabolism
ncy01230  Biosynthesis of amino acids
Module
ncy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ncy_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ncy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NOCYR_0982 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NOCYR_0982 (icd)
Enzymes [BR:ncy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     NOCYR_0982 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: CCF61791
UniProt: H6R1Q7
LinkDB All DBs
Position
1113573..1114790
Genome map
AA seq 405 aa AA seqDB search
MSKIKVEGTVVELDGDEMTRIIWQFIKDKLIHPYLDVNLEYYDLGIEYRDKTDDQVTVDA
ANAIKKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGTIFRAPIIISNVPRL
VPGWTKPIIIGRHAFGDQYRATDFKVFQGGTVTLTFTPDDGSEPIVHEVVKMPEDGGVVM
GMYNFKKSIEDFARASFNYGLQQNYPVYMSTKNTILKAYDGMFKDTFQEIFDAEFKSQFD
AAGLTYEHRLIDDMVASSMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLLTPDG
QTCEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTRGLEHRGKLDNTPEVIGFAQTLE
DVVIKTVEGGQMTKDLALLVGGDQGYLTTEEFLAALDANLARALR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagatcaaggttgaaggcaccgtcgtagaactcgacggcgacgagatgacccgg
atcatctggcagttcatcaaggacaagctgatccacccgtacctcgatgtgaacctcgag
tattacgacctcggcatcgagtaccgcgacaagaccgacgaccaggtcacggtcgacgcc
gccaacgccatcaagaagcacggcgtcggcgtgaagtgtgccaccatcacccccgacgag
gcccgggtcgaggaattcggtctcaagaagatgtggcggtcgcccaacggcaccatccgc
aacattctcggcggcacgatcttccgcgcgccgatcatcatctccaacgttccgcgcctg
gtgcccggctggaccaagccgatcatcatcggccgtcacgccttcggtgaccagtaccgc
gccaccgacttcaaggtgttccagggcggcaccgtcaccctgaccttcacccccgacgac
ggcagcgagccgatcgtgcacgaggtcgtgaagatgcccgaggacggcggcgtcgtcatg
ggtatgtacaacttcaagaagtcgatcgaggatttcgcgcgcgcgtcgttcaactacggg
ctgcagcagaactacccggtctacatgtcgacgaagaacaccatcctgaaggcctacgac
ggcatgttcaaggacaccttccaggagatcttcgacgccgagttcaagagccagttcgac
gcggcgggcctgacctacgagcaccgcctcatcgacgacatggtggcctcctcgatgaag
tgggagggtggctacgtctgggcctgcaagaactacgacggcgacgtgcagtccgacacg
gtggcgcagggcttcggttcgctgggcctgatgacctcggtgctgctgaccccggacggc
cagacctgtgaggccgaggccgcgcacggcaccgtcacccggcactaccgccagcaccag
cagggcaagccgacctcgaccaacccgatcgcgtcgattttcgcctggacccgcggcctc
gagcaccgcggcaagctggacaacacccccgaggtgatcggtttcgcgcagaccctcgaa
gacgtggtcatcaagaccgtcgagggtggtcagatgaccaaggacctcgcgctgctcgtc
ggcggtgaccagggctacctgaccaccgaggaattcctggcggcgctggacgccaacctg
gcgcgcgccctccgctga

DBGET integrated database retrieval system