KEGG   Nocardia cyriacigeorgica: NOCYR_1796Help
Entry
NOCYR_1796        CDS       T01756                                 

Definition
(GenBank) Na+ efflux ABC transporter, ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
ncy  Nocardia cyriacigeorgica
Brite
KEGG Orthology (KO) [BR:ncy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ncy02000]
    NOCYR_1796
Transporters [BR:ncy02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    NOCYR_1796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 DUF4162 AAA_30 AAA_23 AAA_29 AAA_33 DUF3584 SbcCD_C AAA_22 MukB MobB
Motif
Other DBs
NCBI-ProteinID: CCF62582
UniProt: H6RC46
LinkDB All DBs
Position
complement(2009979..2010857)
Genome map
AA seq 292 aa AA seqDB search
MLEVAHLVRRFGDNTAVDDVSFTVAPGTMTGFVGANGAGKTTTMRMIMGVLAAHGGAITW
NSRPVTADDRRSFGYMPEERGLYPKQPVRDQLVYLARLRGLSAAEAKHQASDLLERFSLQ
DRGTDKLESLSLGNQQRVQIAAALIAHPTALILDEPFSGLDPVAVDAMADLLGQYAARGV
PVLFSSHQLDLVERLCDHLVILAKGHVVADGSAEQLRSTGPVRHRLRMAGDTEWLREFTG
VRVVDSNGSAVLLELDGITTDALLTEALIRGSVHELGEVRPSIAEIFREVTA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgctggaagtcgcacacctggtgcgcagattcggcgacaacaccgccgtcgacgacgtc
tccttcaccgtcgccccgggaacgatgaccggcttcgtcggcgccaacggcgcgggcaaa
accaccacgatgcgcatgatcatgggcgtcctcgccgcacatggcggcgcgatcacctgg
aacagccgcccggtcaccgccgacgaccgccgctcgttcggctacatgccggaagaacgc
ggcctctaccccaaacagccggtccgcgaccagctcgtctacctggctcggctgcgcggc
ctgtccgccgccgaagccaaacaccaagcctctgacctgctggaacggttctccctccag
gaccgcggcaccgacaaactcgaatcgctgtctctcggcaaccagcagcgcgtccagatc
gcggcagccctcatcgcgcaccccaccgccctgatcctcgacgaaccgttctccggtctg
gacccggtggccgtcgacgccatggccgacctgctgggacagtacgccgcacgcggcgtg
ccggtgctgttctcctcgcaccaactcgatctggtcgagcggctgtgcgaccacctggtg
attctcgcgaagggccacgtcgtcgccgacggttccgccgagcagctgcgttccaccggc
ccggtccgccatcgcctgcgcatggccggcgacaccgagtggctgcgggaattcaccggc
gtgcgcgtggtcgacagcaacggttcggcggtcctgctcgagctggacggcatcaccacc
gacgcgctgctcaccgaagcgctcatccgtggctcggtgcacgaattgggcgaggtccga
ccgtccatagccgagatcttccgcgaggtgacagcatga

DBGET integrated database retrieval system