KEGG   Nocardia cyriacigeorgica: NOCYR_1849Help
Entry
NOCYR_1849        CDS       T01756                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ncy  Nocardia cyriacigeorgica
Brite
KEGG Orthology (KO) [BR:ncy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncy01001]
    NOCYR_1849
Enzymes [BR:ncy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     NOCYR_1849
Protein kinases [BR:ncy01001]
 Serine/threonine kinases: Other
  Bacterial family
   NOCYR_1849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA Pkinase Pkinase_Tyr APH Kinase-like Kdo Pkinase_fungal RIO1 Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: CCF62635
UniProt: H6RCZ1
LinkDB All DBs
Position
2065524..2067467
Genome map
AA seq 647 aa AA seqDB search
MIGHMLEGRYRIDAPIARGGMSMVFHGEDTRLDRPVAIKVMDPKFAGDPQFLSRFEFEAR
AVAKLKHPSLVAVYDQGVDGDHPFLIMELVEGGTLRELLRERGPMPPHAVRAVAEPVLAA
IGVAHSAGLVHRDIKPENVLISDSGEVKIADFGLVRAVAAANTTSASVILGTAAYLSPEQ
VTSGTADARSDVYSFGILIFELLTGQVPFTGDTSLSVAYQRIENDVPSPSQFIAGVPPEF
DALIARATAREPAHRFADANEMVAELRAISASLELPAYRVPAPQESAEHLSSSYRAAGPA
ADRPRPPEPRPHPAPPQHTKVVTAQRPRTEFAAPPPPPQHVRPHPGPAPAFAGDRNNSRR
TAAVWIAVVAVLTLLVGVGGWWLGVGRFEAVPSIAGMDVEKATAVLTSAGFETTTRQKAS
DTIPVGGVVGSDPSAGSRVTKGSTVAVLISSGKPQVPDVAPGADISEVNQLIRDQGLQPV
DAGEAPSSAPEGTLAKVDPAPGTVLPMGAHVKVYSSKGSQPVTLPDLRGKTTAEAQQMLT
DLGITVSENRPQFDRTVAAGDVVGTDPKAGTTVEAGSSVVLLVSDAVKMPEVLGKSVAEA
RDVLEGLGLTVQVRQLAPLDSSVVVSQTPAMNANVQAGATVTIVALP
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
ttgatcggccacatgctggaagggcgttaccgcatcgatgcgccgatcgctcggggtggg
atgtccatggtgttccacggcgaggacacccgtctggatcgcccggtcgcgatcaaggtg
atggatcccaaattcgccggtgatccgcagttcctgtcgcggttcgagttcgaagcgcgc
gcggtcgccaagctgaaacatccgtcgctggtcgcggtgtacgaccagggcgtcgacggt
gatcatccgttcctgatcatggagttggtcgagggcggcacgctgcgtgaactgctgcgc
gagcgcgggccgatgccgccgcacgcggtgcgcgcggtcgccgagccggtgctcgcggcg
atcggggtggcgcattcggcggggctggtgcaccgcgacatcaaaccggagaacgtgctg
atctccgattccggcgaggtcaagatcgccgacttcggcctggtgcgggcggtggccgcg
gccaacaccacctccgccagcgtcatcctcggcaccgccgcgtacctgtccccggaacag
gtcacctccggcaccgccgacgcccgcagcgacgtctactccttcggcatcctgatcttc
gaactgctcaccgggcaggttccgttcacgggcgacacctcgctgtcggtggcctatcag
cgcatcgagaacgatgtgccgagccccagccagttcatcgccggtgtgccgccggaattc
gacgcgctcatcgcccgggccaccgcccgcgaacccgcgcaccggttcgccgacgccaat
gagatggtcgccgaattgcgggccatcagcgcgtcgctggagctgcccgcctaccgtgtg
cccgcaccgcaggaatcggccgaacacctgagctcgtcctaccgggcggcgggacccgcg
gcggaccggccgcgcccgcccgagccgcgtccgcatccggcgccgccgcagcacaccaag
gtggtgacggcgcagcggccacgcaccgagttcgccgcgccgccgccaccgccgcagcac
gtgcgcccgcatccggggcccgcgccggccttcgccggtgaccgcaacaattcccgccgg
accgccgcggtctggatcgccgtcgtcgcggtgctgacgctactggtcggcgtcggcggt
tggtggctgggggtgggccggttcgaggcggtgccgagcatcgcaggcatggacgtggag
aaggccacggccgtgctcaccagcgccggattcgagaccaccacccggcagaaggcctcc
gacaccatcccggtgggtggtgtggtgggcagcgatccgtctgccggttcccgcgtcacc
aagggctccacggtcgcggtgctgatctccagcggtaagccgcaggtccccgacgtggcg
cccggtgccgacatcagcgaggtgaaccagctgatccgcgaccagggcctgcaaccggtg
gatgccggcgaggcgccgagctcggcacccgagggcaccctggccaaggtcgatccggcg
ccgggcaccgtgctgccgatgggcgcgcacgtgaaggtgtattccagcaagggttcgcag
ccggtgacgctgcccgacctgcgcggcaagaccaccgccgaggcccagcagatgctcacc
gacctcggcatcaccgtcagcgagaaccgtccgcagttcgaccgcacggtggccgccggc
gacgtcgtcggcaccgacccgaaggcaggcacgaccgtcgaggccggttcctcggtggtg
ctgctggtgtcggatgcggtgaagatgccggaggtgctcggcaagtcggtcgccgaagcg
cgcgacgtgctcgagggcctcggcctgacggtgcaggtccgccaactggccccactggat
tcctcggtggtggtgtcgcagacccctgcgatgaacgccaacgtgcaggcgggcgccacc
gtcaccatcgtcgccctgccttga

DBGET integrated database retrieval system