KEGG   Nocardia cyriacigeorgica: NOCYR_2658Help
Entry
NOCYR_2658        CDS       T01756                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
ncy  Nocardia cyriacigeorgica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DUF4443
Motif
Other DBs
NCBI-ProteinID: CCF63428
UniProt: H6R6R5
LinkDB All DBs
Position
complement(2957452..2958537)
Genome map
AA seq 361 aa AA seqDB search
MDLPVMPPVRPMLAKSAPAVPREPGLSYEPKWDGFRCIVFRDGPDIELGSRNDRPLTRYF
PEVAELLKDALPPRCVVDGEIVIVTEAGLDFDTLQLRLHPAASRVAKLAAETPASFVAFD
LLALGDDDLTGQPFRERRRLLETILDTELARVHLTPITADPDVAEDWFTRFEGAGFDGVM
VKADDQRYQQDKRVMLKVKHERTADCVVAGFRWHKDGQGVGSLLLGLYDDEGNLHHVGVA
SSFTAARRKELVDELEPWREGALDNHPWRNWADAAAQASAEGKMPGGMSRWSAGKDLSWE
ALRPELVAEVRYEHVQSGRFRHGGRLVRFRTDRTPESCTYGQLDEVAPAELAAIFGSEVA
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtggacctaccggtgatgccacccgtgcggccgatgctcgccaaatccgcccccgcggta
ccgcgtgagcccggcctgagttacgaacccaaatgggatgggttccggtgcatcgtgttc
cgcgacgggcccgacatcgagctcggctcgcgcaatgaccggccgctgaccaggtacttt
cccgaggtcgccgagctgctgaaggacgcgctgccgccgcggtgcgtggtcgacggcgag
atcgtcatcgtcaccgaggccggcctcgatttcgacaccctgcagttgcggctgcatccg
gcggcctcgcgggtggccaaactcgccgccgaaacccccgcgagtttcgtcgcgttcgat
ctgctcgcgctcggcgacgacgatctgaccggccagccgttccgggaacgcaggcggctg
ctcgagaccatcctcgataccgaactcgcgcgggtgcacctgacgcccatcaccgccgac
cccgatgtcgccgaggactggttcacccgcttcgagggcgccggattcgacggggtgatg
gtcaaggccgacgatcagcggtatcagcaggacaagcgggtgatgctcaaggtcaaacac
gagcgcaccgccgattgtgtggtggccggtttccgctggcacaaggacggtcaaggggtc
ggttcgctgctgctggggctctacgacgacgagggcaacctgcatcatgtgggggtcgcg
agcagcttcaccgccgcccggcgcaaagagctcgtcgacgagctcgagccgtggcgggag
ggcgcgctggacaaccatccgtggcgcaactgggccgatgcggccgcgcaggcctcggcc
gagggcaagatgccgggcgggatgagccgttggagcgcgggcaaggatctgtcctgggag
gcgctgcgacccgaactcgtcgccgaggtccgctatgagcatgtgcagtcgggccggttc
cggcacggcggcaggctggtgcggttccgcaccgaccgcacaccggaatcgtgcacctac
ggccagctcgacgaggtggctccggccgaactggccgcgatcttcggttccgaggtggcg
cgatga

DBGET integrated database retrieval system