KEGG   Nocardia cyriacigeorgica: NOCYR_3763Help
Entry
NOCYR_3763        CDS       T01756                                 

Definition
(GenBank) putative 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
ncy00250  Alanine, aspartate and glutamate metabolism
ncy00410  beta-Alanine metabolism
ncy00640  Propanoate metabolism
ncy00650  Butanoate metabolism
ncy01100  Metabolic pathways
ncy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ncy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    NOCYR_3763
   00650 Butanoate metabolism
    NOCYR_3763
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NOCYR_3763
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NOCYR_3763
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ncy01007]
    NOCYR_3763
Enzymes [BR:ncy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     NOCYR_3763
Amino acid related enzymes [BR:ncy01007]
 Aminotransferase (transaminase)
  Class III
   NOCYR_3763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CCF64526
UniProt: H6R412
LinkDB All DBs
Position
4149869..4151128
Genome map
AA seq 419 aa AA seqDB search
MTALSPILKQATPVTVDHGAGCYLYDTDGRRYLDFTAGIGVTSTGHCHPHVVAAAQAQVA
RLIHGQYTTVMHRPLLELTERLGAVLPDGLDSLFFANSGSEAIEAALRLARQATGRPNVV
VFHGGFHGRTVAAASMTTSGTRFSAGFSPLMAGVHVAPFPTAYRYGWSEEEATAFALREL
DYLFATLTAPEETAAFIVEPVLGEGGYVPGNRTFFRGLRERADRHGIVLVFDEIQTGFGR
TGKFFGHQHFDVEPDVITIAKGLASGFPLSGIAASRELMAKAWPGSQGGTYGGNAVACAA
AIATLEVIESEGLVQNAAERGAQLLAGMQALESKAVGDVRGLGLLVGAEFVTAAGEPDRE
TATAAQQLAVQKGLLLLTCGAHMNVVRMIPPLVVSRSQIEDALAIWAQVLAELPGTAQP
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgttatcgcccatcctgaaacaagccactccggtgaccgtcgaccacggcgcg
ggctgctacctctacgacaccgacggccgccgctacctggacttcaccgcgggcatcggc
gtcaccagcaccggccactgccatccgcacgtcgtcgcggccgcgcaggcccaggtcgcc
cggctcatccacggccagtacacgacggtcatgcaccgtccgctgctcgaactcaccgag
cggctcggggccgtgctgccggacgggctggattcactgttcttcgccaactccggcagc
gaggcgatcgaggccgcgctgcggctggcccggcaggcaaccggacggcccaatgtcgtc
gtcttccacggcggtttccacggccggaccgtcgccgcggcctccatgaccacctcggga
acccggttctcggcggggttcagtccgttgatggcgggcgtacacgtcgcgccgttcccc
accgcctaccgctacggatggagcgaggaggaagcgaccgccttcgccttgcgcgaactc
gactatctgttcgcgacactcaccgcaccggaggagaccgcggccttcatcgtcgaaccg
gtgctcggcgagggcggctatgtccccggcaaccggacgttcttccgcgggctgcgcgag
cgcgccgaccggcacggcatcgtgctggtcttcgacgagatccagaccgggttcggccgg
accggaaagttcttcggccaccagcatttcgacgtcgaacccgacgtcatcaccattgcc
aagggcctggcgagcgggttccccctgtcgggtatcgccgcgtcgcgcgagttgatggcc
aaggcctggccggggtcgcagggcggcacctacggcggcaatgccgtggcctgcgctgcc
gccatcgccacgctggaagtcatcgaatccgagggcctggtgcagaacgcggccgagcgc
ggcgcgcagttgctggccgggatgcaggcgctggagagcaaagcggtcggcgatgtgcgc
gggcttggtctgctcgtcggcgcggaattcgtcacggccgcgggcgaacccgatcgcgag
accgccaccgccgcacaacagctggcggtccagaaggggctgctgctgctcacctgcggt
gcgcacatgaacgtggtgcggatgattccgccgctggtggtgagccggtcccagatcgag
gacgccttggcgatctgggcgcaggtcctcgccgaactccccggcaccgcccagccgtag

DBGET integrated database retrieval system