KEGG   Nocardia cyriacigeorgica: NOCYR_3974Help
Entry
NOCYR_3974        CDS       T01756                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
ncy00010  Glycolysis / Gluconeogenesis
ncy00030  Pentose phosphate pathway
ncy00051  Fructose and mannose metabolism
ncy00052  Galactose metabolism
ncy00680  Methane metabolism
ncy01100  Metabolic pathways
ncy01110  Biosynthesis of secondary metabolites
ncy01120  Microbial metabolism in diverse environments
ncy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ncy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NOCYR_3974 (pfkA)
   00030 Pentose phosphate pathway
    NOCYR_3974 (pfkA)
   00051 Fructose and mannose metabolism
    NOCYR_3974 (pfkA)
   00052 Galactose metabolism
    NOCYR_3974 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    NOCYR_3974 (pfkA)
Enzymes [BR:ncy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     NOCYR_3974 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     NOCYR_3974 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: CCF64735
UniProt: H6R716
LinkDB All DBs
Position
complement(4375871..4376854)
Genome map
AA seq 327 aa AA seqDB search
MIRAVVRTANGRYGDAIVGFQDGWRGLLEDRKIQILNDDRTDRLLNKGGTMLGTARTNPD
VLREGLGRIQQTLDDNGIEALIPIGGEGTLTAASWLSDEGVPVVGVPKTIDNDIDCTDVT
FGHDTALAIATEAIDRLHTTAESHQRVMLVEVMGRHAGWIAIHAGMAAGAHLTLVPEVPF
DVQQVCAMIKRRFQRGDKHFICVVAEGSHPAPDSGFTLREGGVDEFGHERFTGVAQQLGV
EIERRIGKEVRTTVLGHVQRGGSPTPYDRVLATRFGLHAAEAVHAGHFGQMVALRGTEIG
LVPLSEATKQLKRVPAERYREAEAFFG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgattcgcgccgtcgttcgcaccgcgaacgggcgttacggtgacgcgatcgtcggcttc
caggacggctggcgcggcctactcgaagatcgcaagatccagatcctgaacgacgaccgg
accgaccggctgctcaacaagggcggcaccatgctcggcaccgcgcgcaccaatcccgac
gtgctgcgcgaggggctcggccggatccagcagaccctcgacgacaacggcatcgaggcc
ctcattccgatcggcggcgagggcaccctgaccgcggccagctggctgtccgatgaaggg
gtgcccgtcgtcggcgtgcccaaaaccatcgataacgacatcgactgcaccgacgtcaca
ttcggccacgacaccgcgctggccatcgccaccgaggcgatcgaccggctgcacaccacc
gcggaatcgcatcagcgggtcatgctggtggaggtcatgggccggcacgcgggctggatc
gcgatccacgcaggcatggccgcgggcgcgcacctgacgctggtgccggaggttcccttc
gacgtgcagcaggtgtgcgcgatgatcaagcgccgtttccagcgcggcgacaagcatttc
atctgtgtggtggccgaaggctcgcatcccgcgcccgattccggcttcaccctgcgtgag
ggcggcgtcgacgagttcgggcacgagcggttcaccggtgtggcccagcagttgggcgtc
gagatcgagcgccggatcggcaaggaggtccgcaccaccgtgctcggccacgtgcagcgc
ggcggcagccccaccccgtacgaccgggtgctggccacccgcttcggcctgcacgccgcc
gaggccgtgcacgccgggcatttcgggcagatggtcgcgctgcgcggcaccgagatcggc
ctggtgccgctgtcggaggcgaccaagcagctcaagcgggttccggccgagcggtatcgg
gaagcggaggcgttcttcggctga

DBGET integrated database retrieval system