KEGG   Nocardia cyriacigeorgica: NOCYR_5340Help
Entry
NOCYR_5340        CDS       T01756                                 

Definition
(GenBank) Betaine aldehyde dehydrogenase (BADH)
Organism
ncy  Nocardia cyriacigeorgica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CCF66089
UniProt: H6R8E2
LinkDB All DBs
Position
5945649..5947094
Genome map
AA seq 481 aa AA seqDB search
MDYDSLFIGGRWTAPATTERIQVISPATEEPVGSVPAVDRADVDAAVAAARAAFDSGPWP
STPPEERAQVLTRAARLIEERGADLAATLTAEMGAPLMAATTLNQIPAVAALDYYAGLAK
SFPWNETRTGVFGTTRVSREPRGVVAAITAWNVPLFLAVNKLGPALLAGCTVVLKPSPLT
PLTTNKVAEIFAEAGLPEGVLSVLPAEAEASEYLVSHPGVDKLTFTGSTAVGRKIGAIAT
GQLKSVSLELGGKSAAILLPDMDIAASIPSLAFSGLMNTGQGCVAQTRILAPRSHYDEIL
EALVAHVRTMTVGDPTDPATQLGPLISQRQRERVEGYIAKGKAEGARLVLGGGRPEGLDK
GWFVEPTIFADVDNASTIAREEIFGPVLSVIPYDTEDEAVALANDSDYGLAGSVWTTDVE
HGAEIAARVRTGTYAINWYAFDPTAPFGGYKNSGLGRENGPEGLDAYCEQKSVLMPLGWT
G
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggattacgacagcctcttcatcggcggccgctggaccgcgcccgccaccaccgagcgc
atccaggtcatctccccggccaccgaggagccggtcggcagcgttcccgcggtcgaccgg
gccgacgtcgacgccgccgtcgccgcggcccgcgccgccttcgattcgggcccgtggccg
tcgacgccgccggaggagcgggcccaggtgctcacccgtgccgcccgcctgatcgaggaa
cgcggcgccgacctggccgccaccctcaccgccgagatgggcgccccgctgatggcggcg
accaccctcaaccagatcccggccgtggccgcgctcgattactacgcggggctggcgaaa
tcgttcccgtggaacgagacgcgcaccggcgtgttcggcaccacccgggtctcccgcgaa
ccgcgcggtgtggtcgccgcgatcaccgcgtggaatgtgccgctgttcctggcggtcaac
aagctgggcccggcactgctggccggctgcaccgtggtgctcaagccctccccgctgacg
ccgctgaccaccaacaaggtggccgagatcttcgccgaggccggcctgcccgagggcgtg
ctgtcggtgctgcccgccgaggccgaagcctcggagtacctggtctcgcatccgggggtg
gacaagctgaccttcaccggcagcaccgccgtcggccgcaagatcggcgccatcgccacc
gggcagctgaagtcggtgtcgctggaactcggtggcaaatcggcggcaatcctgttgccg
gacatggatatcgccgcgagcatcccgtcgctggccttctccggcctgatgaacaccggc
cagggctgtgtcgcgcagacccgaatcctggcgccgcgcagccactatgacgaaatcctc
gaggcgctggtcgctcatgtgcgcacgatgaccgtcggcgatcccaccgatccggcgacc
cagctcggcccgctgatctcgcagcggcagcgcgaacgcgtcgagggctacatcgccaag
ggcaaggccgagggcgcgcgcctggtgctgggcggcggcaggcccgagggactcgacaag
ggctggttcgtggagccgaccatcttcgccgatgtggacaacgcctcgacgatcgcgcgg
gaagagattttcgggccggtactttcggtgattccgtacgacaccgaggacgaagccgtc
gccctggccaacgattccgattacggcctggccggttcggtgtggaccaccgatgtggag
cacggcgccgagatcgccgcgcgggtgcgcaccggcacctacgcgatcaactggtacgcc
ttcgatcccaccgcgccgttcggcggatacaagaactccggcctcggccgcgagaacggt
cccgaggggctcgacgcgtactgcgaacagaagtcggtgctgatgccgctgggctggacc
ggctag

DBGET integrated database retrieval system