KEGG   Nocardiopsis dassonvillei: Ndas_0192Help
Entry
Ndas_0192         CDS       T01248                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
nda  Nocardiopsis dassonvillei
Pathway
nda00473  D-Alanine metabolism
nda00550  Peptidoglycan biosynthesis
nda01100  Metabolic pathways
nda01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nda00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Ndas_0192
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ndas_0192
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Ndas_0192
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nda01011]
    Ndas_0192
Enzymes [BR:nda01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Ndas_0192
Peptidoglycan biosynthesis and degradation proteins [BR:nda01011]
 Precursor biosynthesis
  Amino acid ligase
   Ndas_0192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 GARS_A ATPgrasp_ST ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ADH65642
UniProt: D7AU84
LinkDB All DBs
Position
1:242784..243908
Genome map
AA seq 374 aa AA seqDB search
MSSEQRKIRVAVVFGGRSSEHEISCVTAGSVLSVVDHDRYEIVPVGITRTGNWVLTSGDP
ESLRIDAGTRALPSVSEDGVDLALPFDSAGQLMVVDPVKGPERLAGVDVVLPLLHGPFGE
DGTIQGLFEMMGVRYAGAGVFSSSASMDKVFMKAMLRGNGIPTSDFVAITDRQWRTERKR
VLDDVAELGATVFVKPARAGSSVGISKVEDSSDADAVVAAVEAAREHDPKVLVEAQVVGR
EVECGVLESEDGGTPDVSLPAEVHVADGFDFYDFEAKYLSTSSLTIPAELPEEATARLRA
LAAEVFEAMGCEGLARVDFFYTEDGDILVNELNTMPGFTPASAFPQMWAATGVDYAALVE
RMISTALRRAPGLR
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccgaacagcgcaagattcgggtggccgtcgtcttcggcgggcgtagctccgaa
cacgagatctcctgcgtcaccgcgggcagcgtgctgtccgtcgtcgaccacgaccgctac
gagatcgtgccggtcggtatcacccgtacgggcaactgggtgctgacctcgggcgacccc
gagagcctgcgcatcgacgcgggcacccgagcgctgccgtcggtgtccgaggacggcgtc
gacctcgcgctgcccttcgactcggcgggccagctgatggtcgtggacccggtcaagggc
cccgagcgcctggccggggtggacgtggtgctgccgctgctgcacggccccttcggcgag
gacggcaccatccaggggctgttcgagatgatgggcgtgcgctacgccggggccggggtg
ttctccagctccgcctccatggacaaggtcttcatgaaggccatgctgcgcggcaacggc
atccccaccagcgacttcgtggccatcaccgaccgccagtggcgcaccgagcgcaagagg
gtgctggacgacgtggccgagctgggcgccaccgtgttcgtcaagcccgcccgcgcgggc
agcagcgtcggcatcagcaaggtggaggactcctccgacgccgacgcggtggtcgccgcg
gtcgaggccgcccgcgagcacgaccccaaggtcctggtggaggcccaggtcgtgggccgc
gaggtggagtgcggcgtgctggagtccgaggacggcggcacgcccgacgtgtccctcccg
gccgaggtgcacgtcgccgacggcttcgacttctacgacttcgaggccaagtacctgtcc
acgagcagcctgaccatcccggccgagctccccgaggaggccacggcgcgtctgcgcgcg
ctggccgccgaggtgttcgaggcgatggggtgcgagggcctggcccgagtggacttcttc
tacaccgaggacggcgacatcctcgtcaacgagctcaacaccatgcccggcttcaccccg
gcgtcggccttcccgcagatgtgggccgccaccggcgtggactacgcggccctggtggag
cggatgatctccacggcgctgcgccgcgcccccggcctgcggtag

DBGET integrated database retrieval system