KEGG   Nocardiopsis dassonvillei: Ndas_0258Help
Entry
Ndas_0258         CDS       T01248                                 

Definition
(GenBank) DNA polymerase LigD, polymerase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
nda  Nocardiopsis dassonvillei
Pathway
nda03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:nda00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Ndas_0258
Enzymes [BR:nda01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Ndas_0258
DNA repair and recombination proteins [BR:nda03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Ndas_0258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ADH65707
UniProt: D7AUE9
LinkDB All DBs
Position
1:322784..323662
Genome map
AA seq 292 aa AA seqDB search
MATETAKVRAGRRVVEVRRPGKPLFGEGGATKEDLARYHARIAPLMLPHVRDRPVALARF
PDGIDAQGFFVKHPSVPDWVATVETSGGRMMLCQDAAALVWCADQAAVTLHAWQSREPRL
GLPDRMVIDLDPAGDGPEAFAACRAAARDVREVLDDLGLAAYVMTSGSRGLHVRSPLRPE
ADDQEVRVLAEAVADRVAARRPEELTTEVRKAARGDRLFVDYLRNGREQLAVVPYSVRAR
PGAPIAAPLTWEDLEKVETARDLTIDLEREKCPFAGMGRHARSPRRALERLG
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggagaccgcgaaggtgcgcgcgggacggcgcgtggtggaggtgcgcaggccc
ggcaagccgctgttcggcgagggcggggcgaccaaggaggacctggcgcggtaccacgcc
cggatcgcccccctgatgctgccgcacgtgcgcgaccggccggtggccctggcgagattc
cccgacgggatcgacgcgcaggggttcttcgtcaagcacccgtcggttccggactgggtg
gccactgtggagaccagcggcggccggatgatgctgtgccaggacgcggccgcgctggtc
tggtgcgccgaccaggctgcggtcaccctgcacgcctggcagtcccgggagccgagactg
ggcctgcccgaccggatggtgatcgacctcgaccccgccggggacggccccgaggccttc
gccgcctgccgcgccgcggcgcgggacgtgcgggaggtgctcgacgacctgggcctggcc
gcctacgtgatgaccagcggctcccggggcctgcacgtgcgctcgccgctgcggcccgag
gccgacgaccaggaggtccgcgtgctggcggaggcggtcgcggaccgggtggcggcccgg
cggccggaagagctgaccaccgaggtgcgcaaagccgcgcgcggggaccggttgttcgtg
gactacctgcgcaacggccgcgaacagctcgcggtggtgccgtactcggtgcgggccagg
ccgggcgcgcccatcgcggcgcccctgacctgggaggacctggagaaggtggagactgcc
cgggacctcacgatcgacctggagcgcgagaagtgcccgttcgcggggatgggcaggcac
gcccgttccccgcgccgggccctggagcgcttgggctga

DBGET integrated database retrieval system