KEGG   Nocardiopsis dassonvillei: Ndas_0496Help
Entry
Ndas_0496         CDS       T01248                                 

Definition
(GenBank) Acyl transferase
Organism
nda  Nocardiopsis dassonvillei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_1 ketoacyl-synt KR PS-DH Ketoacyl-synt_C PP-binding KAsynt_C_assoc PikAIV_N adh_short Thioesterase adh_short_C2 Epimerase Thiolase_N NAD_binding_4 GDP_Man_Dehyd ACP_syn_III 3Beta_HSD Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: ADH65943
UniProt: D7AWH7
LinkDB All DBs
Position
1:606759..613031
Genome map
AA seq 2090 aa AA seqDB search
MHKPADGRPDERVVQALRASVKENERLREQNRRLVEAATEPVAITGMACRYPGGVQTPEQ
LWDLLIAERDTVSAFPDDRGWDLAGLFDDDPDRPGRSYVRAASFLDDPAGFDAAFFGISP
KEAQAMEPQQRLLLECAWEAVERAGTDPTTLRGTRTGVFAGVVAVPYGPRAVDATDGSEG
HLITGTAPSVAAGRVSYTLGLEGPAVSFDTACSSSLTALHAAVESLRRGECERALVGGVS
VVTDPAVFAGLSGQRALSPDGRSKAFDAAADGTGWSEGCGVLVVERLSDARRHGRPVLAL
VRGVAVNQDGASSGLTAPNGSAQRRVITRALEAAGVTADQVDAVEAHGTGTALGDPIEAE
ALIATYGRAHTPEAPLHLGSLKSNIGHTVAAAGVSGVIKTVLALRNETLPRTLHLTEPTP
RVNWSAGTVVPLTEARPWPRREDRPRRAGVSAFGMSGTNAHAVLEEAPAAEPAPAAPADA
PPAASDLVPWPVSARGAAALAAQAARLADHLDAHPDLAPADVGHTLATARADLPDRAVVL
SADTDGFREALRALAEGRDTAAVVRGRVREQAKTALVFPGQGSQWIGMAVSLMDTVPEFA
DRIDQCQKAFASHLDWSLASVLRGEPGAPGLERIDVVQPVLFAVMVALADLWRAHGLRPS
AVVGHSQGEIAAAHVAGALSLEDAARVVITRSRLLTSLVGRGAMATLALSADEAAKRIGP
WEGQLSVAVVNGPGTVVVAGDKQAVAELVGDCEADGIKVRRIHEDVAGHSPHVEALRADL
VAALAGIRPRPTNLPLYSTVTGERIEGTALDAEYWYRNLRRTVLFEPAVRALHEAGFTAF
VEVSSHPVTTYGIQQTVEAAGGDESAVLHTLRREEGGYGHFLTALARAHVSGVAVDWTRA
HAPHAPRAVELPTYAFQRDRYWLVPGRASDVLGSGADPAGHPLLGAAVDLPDGEGHLFTG
QLSLATAPWLADHAVGSTVVLPGAAHLDLVLHAAEHVGLPSVAELTLLAPLALRPGADTR
LQVAVSGPDASGRRSVRVHARPADRSDGWTLHAEGLLEPASAPAPGTASAQTAPPPEAEP
VPVDGLYADLARDGYGYGPAFQGLRAAWREGGRVWAEARLPDGHREDAAAFGVHPALLDA
AQHAIALTAPGESGRVRLPFSWTGVRLYASGADHLRVHVSPVGPDEYALTMTDTDGNPVL
TAESLAVRPVDAARVEEEARRALPRELYALEWPTVDLADTGPLPALAVLAPDTTGLTEAL
ARTGAVVHLVTGLEELRELPGETVVLAPFAAAVPEAGTARVETAEETPAASGAGVPEDAG
ASLRRALELLQEWSADEGATDHRLIVVTRGAVAVAPEEDVTDLVHAPLWGLLRSAQAEQP
DRFTVVDLDGSDAAAATLTRALASGEPQLALRGSTAHAPRFTRARVPGESAAPDLGGGTV
LVTGATGVLGSAVARRLVERHGARDLLLLSRRGGGAPGATALVEELTSLGARAAFAACDV
SDADALAAVIDAVPEERPLRAVVHVAGGIDDGVLATLTPESLDAVMRPKADAAHHLHRLT
EHLDLAAFVLFSSAAGVLGSPGQANYAAANTFLDALAHHRRSRGMAAQSLSWGLWERLGE
AGSHLEAADISRLRRLGMARTLEQREALDLLNAALACGAPHLVPLPLDLEGVRDRAARTG
QVPPLMRGLVRQPRYRASKGGAAEGAGVSAALAASTGEERERLLLELVGALTTEVLGRPG
DESPDPDQDFLELGMDSLTAVELRNELRAATGLRLTASVVLAHSTPARLARHLAAELPEP
GSAAPTAVADTAGADPLEGAVPLFRESCRQGRIADGIRMVQAASRLRPEFTGPEDFGALP
RPVTVARGPVLPRMVCLPSLVMVSGVQEYARFGAALQGLREVVVLPQPGFTPGDPLPRTL
EAALAVQARAVREVVGDEPYVLVSRSSGGWVTHSVATLMEAGGHAPGAVVLMDTPMPEEP
TAFPIIQAGVLERETRFGLMDGTRVTAMGRYIGLCADWEPAPTAVPTLAVRPGQQMLDAS
GTPIGGRDWRFDWPLPHEAVDVDGDHITMLEEHGPDTALTVHRWLEEHVR
NT seq 6273 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagccagccgacggccgccccgacgagcgtgtggtccaggcgctgcgcgcctcc
gtcaaggagaacgaacgcctgcgcgagcagaaccggcgcctggtggaggccgcgaccgag
ccggtggcgatcaccgggatggcctgccgctaccccggcggcgtccagacccccgaacag
ctgtgggacctgctgatcgccgagcgggacaccgtctcggccttccccgacgaccggggg
tgggatctggcggggctgttcgacgacgaccccgaccggcccggccgcagctacgtgcgt
gccgcctccttcctcgacgacccggccgggttcgacgccgccttcttcgggatctccccc
aaggaggcccaggccatggagccccagcagcgcctgctgctggagtgcgcctgggaggcc
gtcgagcgcgccggaaccgaccccaccacgctgcgcggcacccgcaccggcgtgttcgcc
ggggtggtcgccgtcccctacgggccgcgcgcggtggacgccacggacggcagcgagggc
cacctgatcacgggcaccgcccccagcgtcgccgcgggccgcgtctcctacaccctgggg
ctggagggcccggcggtcagcttcgacaccgcctgctcctcctccctgaccgcgctgcac
gccgccgtggagtccctgcgccgcggcgagtgcgagcgcgccctggtcggcggggtcagc
gtggtcaccgacccggccgtgttcgccgggctcagcggccagcgcgcgctctcgcccgac
ggccgcagcaaggccttcgacgccgcggccgacggcaccggctggagcgagggctgcgga
gtgctcgtggtggaacgcctctccgacgcccgccgccacggccgccccgtcctggccctg
gtgcgcggcgtggccgtcaaccaggacggtgccagcagcgggctcaccgcgcccaacgga
tcggcccagcgcagggtcatcacacgggcgctggaggccgccggggtcaccgccgaccag
gtcgacgcggtggaggcgcacggcaccggcaccgccctgggcgaccccatcgaggccgag
gccctcatcgccacctacggcagggcgcacacacccgaggccccgctccacttgggctca
ctcaagtccaacatcggccacaccgtcgccgccgccggggtctccggcgtcatcaagacg
gtgctggcgctgcgcaacgagacgctgccgcgcaccctgcacctgaccgagcccaccccc
cgagtgaactggtcggccgggaccgtcgtcccgctcacggaggcccggccctggccgcgc
agggaggaccgcccccgccgggccggagtgtcggccttcggtatgagcggcaccaacgcc
cacgccgtgctggaggaggcgcccgcggcggaacccgccccggccgcccccgccgacgcg
ccccccgccgccagcgacctcgtgccctggccggtctcggcgcggggcgcggccgcgctc
gccgcccaggccgcccgtctcgccgaccacctcgacgcccaccccgacctcgctcccgcc
gacgtcgggcacaccctggccaccgcccgcgccgacctgcccgaccgcgcggtggtcctg
tccgccgacaccgacggcttccgcgaggccctgcgcgccctggccgagggtcgcgacacc
gccgccgtcgtgcgcgggcgcgtgcgcgaacaggccaagaccgccctggtcttccccggc
caggggtcgcagtggatcggcatggccgtgtccctgatggacaccgtccccgagttcgcc
gaccggatcgaccagtgccagaaggcgttcgcgtcccacctggactggtccctggcctcc
gtgctgcgcggtgagcccggagcgcccggtctggagcgcatcgacgtggtccagccggtg
ctgttcgccgtgatggtcgccctcgcggacctgtggcgcgcccacggcctacgcccctcg
gcggtcgtcggccactcccagggcgagatcgccgccgcccatgtggccggggccctcagc
ctggaggacgccgcgcgcgtggtcatcacccgcagccgcctgctcacctccctggtcggc
cggggcgccatggccaccctggcgctgtccgccgacgaggccgccaagcgcatcgggccc
tgggaggggcagctctcggtggccgtcgtcaacggacccggcaccgtggtcgtggccggg
gacaagcaggccgtcgccgaactggtcggggactgcgaggccgacgggatcaaggtccgc
cgcatccacgaggacgtcgccgggcactcgccgcacgtggaggccctgcgagcggacctg
gtcgcggcgctcgccggcatccgtccccggcccaccaacctccccctgtactccaccgtc
accggggagcgcatcgagggcaccgccctggacgccgagtactggtaccgcaacctgcgc
cggaccgtgctgttcgagcccgcggtccgcgccctgcacgaggccggattcaccgcgttc
gtggaggtcagcagccacccggtgaccacctacggcatccagcagaccgtggaggccgcg
ggcggcgacgagtccgcggtcctgcacaccctgcgcagggaggagggcggttacgggcac
ttcctcaccgccctggcccgggcccatgtgagcggcgtggccgtggactggacgcgcgcc
cacgccccccacgctccccgggccgtggaactgcccacctacgccttccaacgcgaccgg
tactggctggtccccggccgggcctcggacgtgctcggctccggtgcggacccggccggg
cacccgctgctcggtgccgcggtggacctgcccgacggggagggacacctgttcaccggc
cagctgtccctggccacggcaccctggctcgccgaccacgccgtgggcagcacggtcgtc
ctgcccggcgccgcccacctggacctggtcctgcacgccgccgagcacgtgggcctgccg
agcgtggccgagctgaccctgctcgcgcccctggccctgcgcccgggcgccgacacccgg
ctccaggtagcggtgtccggacccgacgcctccgggcggcgctccgtccgggtgcacgcg
cgtcccgccgaccggtccgacgggtggaccctgcacgccgagggcctcctcgaacccgcc
tccgcgcccgcacccggaaccgcgtccgcccagaccgccccgccaccggaggccgaaccc
gtgcccgtggacggcctgtacgccgacctggcccgcgacggctacggctacggccccgcc
ttccagggactgcgcgcggcctggcgcgagggcggacgggtgtgggccgaggcgcgcctg
cccgacggccaccgcgaggacgccgccgccttcggcgtgcaccccgccctgctggacgcc
gcccagcacgccatcgccctgaccgcgcccggggagagcggccgggtacggctgcccttc
tcctggacgggcgtgcgcctgtacgcgtccggggccgatcacctgcgggtgcacgtcagc
ccggtgggccccgacgagtacgcgctgaccatgaccgacaccgacggcaaccccgtcctg
accgccgagtccctggccgtgcgccccgtcgacgccgcgcgtgtggaggaggaggccagg
cgggccctgccccgggagctgtacgccctggaatggcccaccgtggacctggccgacacc
gggccgctcccggccctggccgtcctggctcccgacaccaccggactgaccgaggcgctc
gcccgcaccggtgccgtcgtgcacctggtcaccggcctggaggagctgcgcgaactgccc
ggggagaccgtcgtcctggcgcccttcgccgccgcggtcccggaggcgggcaccgcgcgg
gtggagaccgccgaggagacgcccgcggcctcgggcgcgggcgtccccgaggacgcgggc
gccagtctgcggcgggcgctggaactgctccaggagtggagcgccgacgagggcgcgacc
gaccaccgcctcatcgtcgtcacccggggcgcggtcgcggtggccccggaggaggacgtc
accgacctcgtccacgccccgctgtggggtctgctgcgctccgcgcaggccgaacagccc
gaccggttcaccgtcgtggacctggacggttccgacgccgctgccgccacgctcacgagg
gccctggccagcggcgaaccgcagctcgcgctgcgcggttccaccgcgcacgccccccgc
ttcaccagggcgcgcgtcccgggggagtccgccgcccccgacctcggcggcggaaccgtc
ctggtcaccggcgccaccggcgtgctcggctcggcggtcgcccgccgcctggtcgagcgc
cacggcgcgcgcgacctgctgctgctcagccgccggggcggcggcgcgcccggcgcgacc
gcgctggtggaggagctgacctccctgggcgcacgagccgcgttcgcggcgtgcgacgtc
tccgacgcggacgccctggccgccgtcatcgacgcggtgcccgaggaacggcccctacgg
gcggtggtgcacgtcgccgggggcatcgacgacggtgtgctggccaccctgacccccgag
agcctcgacgcggtgatgcggcccaaggccgacgccgcccaccacctgcaccggctgacc
gagcacctggacctggcggcgttcgtgctcttctcctcggccgcgggcgtcctgggcagc
ccgggccaggccaactacgccgccgcgaacaccttcctggacgccctggcccaccaccgc
cgctcccggggcatggcggcccagtcgctgtcgtggggcctgtgggaacggctgggcgag
gccggttcgcacctggaggccgccgacatctcacgcctgcgccgtctgggcatggcgcgg
accctggagcagcgggaggccctggacctgctgaacgccgcgctggcctgcggagcgccc
cacctggttccgctgccgctggacctggagggcgtgcgcgaccgcgccgcccgcaccggt
caggtgccgccgctgatgcgcggactggtccgccagccccgataccgcgcctccaagggc
ggggccgccgagggggcgggcgtgtccgcggcgctggcggccagcaccggggaggagcgc
gagcgcctgctgctggagctggtgggcgcgctcaccaccgaggtgctgggccgtcccggg
gacgagagccccgaccccgaccaggacttcctcgagttgggcatggactcgctcaccgcc
gtggaactgcgcaacgagctgcgcgctgcgacggggctgcgtctgaccgcgtcggtggtg
ctggcgcactccacgcccgcccggctggcccgccacctggccgcagaacttcccgagccg
gggagcgccgcgccgaccgccgtcgcggacacggccggggccgaccccctggagggggcc
gtgccgctgttccgcgagtcgtgccgccaggggcggatcgccgacggcatccgcatggtc
caggcggcctcccgcctgcgcccggagttcaccggtccggaggacttcggcgcgctgccg
cgcccggtcacggtggcccggggaccggtgctcccgcgcatggtctgcctgccgtcgctg
gtcatggtgtcgggcgttcaggagtacgcgcgcttcggcgcggccctccaggggctgcgc
gaggtcgtggtcctgccccagcccggcttcaccccgggggacccgctgccccggaccctg
gaggcggccctggccgtgcaggcccgggccgtgcgcgaggtggtcggcgacgaaccctac
gtgctggtcagccgctcctccggcgggtgggtgacacacagcgtcgccaccctcatggaa
gccggggggcacgcgcccggggcggtggtcctgatggacacgcccatgcccgaggagccc
accgccttcccgatcatccaggccggagtgctggagcgcgagacccggttcgggctgatg
gacggcacccgggtcaccgccatgggacgctacatcggactgtgcgcggactgggagccc
gcgcccaccgctgtgccgaccctggccgtgcgccccggacagcagatgctcgacgcctcg
gggacgccgatcggcggccgggactggcggttcgactggccgctgccgcacgaggccgtc
gacgtggacggcgaccacatcaccatgctggaggagcacgggccggacacggcgctgacc
gtccaccgctggttggaggagcacgtccgttag

DBGET integrated database retrieval system