KEGG   Nocardiopsis dassonvillei: Ndas_1204Help
Entry
Ndas_1204         CDS       T01248                                 

Definition
(GenBank) hypothetical protein
Organism
nda  Nocardiopsis dassonvillei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OCRE
Motif
Other DBs
NCBI-ProteinID: ADH66643
UniProt: D7B222
LinkDB All DBs
Position
1:complement(1461555..1464905)
Genome map
AA seq 1116 aa AA seqDB search
MPEPEIKYEDLPDKPLHELMNIFAGTDGDYKPMESIDTVTKDPWVADGRYHFHETTNPFT
GFSWNYGGHEMDRWWSYREYYTAYTTGYGGGSYPYETYGIDYAGYTMQKHLWGEKTLSDG
KEDLHTDDTPPPQDGFRQQLSNLAHLADYGNNQLTSENWDLTRLQKTIDSLGTLYDTLTP
YIDGEGGSLNKLWQEIDVPDGAMQGSAAAAYKYRLQDMAYRMTSVHMELPEFKAELERVK
TVLTFATAVLAYTVDQALNTRGGRVQEVLDDWYFYTSAGTEEFNPERDQFQVTIAYPEET
GGDKLTGIPGDPPTQDNINNVLYQRFRNHYEGVYEAANQVRDLMAHTYTQAHATIPVIVD
PAPLPPPTPETGGGGNGPGGENPFGDWEIDNPFGDWEIDNPFGDWDNEGGGPPPPPPPPP
PPPQLPYNGPGTGGQGPGNEEFLPPPPPPNLGLNGPGTGNPEGLGGPPPPTPDLGLNGPG
FDQLGNNSLVPPPPPNDLGLNGPGLGQGGNNGSFVPPPPPNDLGLNGPGLGQGGNNGSFV
PPPPPNDLGLNGPGFGSGGGNDPGTNGPFIPPPPPPNLGLNGPGSGRGGYNGSLERDPAT
GLPINPETGQPFPVDPETGLPYNPDTGLPINYDPETGRALPIDPVTGEPVPIGERGSSLE
FDPATGLPINPETGQPFPVDPETGLPYNPDTGLPINYDPETGQALPIDPVTGLPINYDPQ
TGQALPIDPVTGEPVPIGERGSSLEFDPATGLPINPETGQPFPVDPETGLPYNPETELPI
NYDPETGQVLPIDPVTGQPVGIDPVTGLPTDYDYGLQPPLPPPDLGLNGPGTSDDYDYGL
RPPPLPEDLGLNGPGSGSDVPINPITGEPYVIDPMTGRPYPINPETGEPIRSNYTGPGQE
PPDVLPPPLAPDDRGLNYGGLSPSPYSSDGPGAPDSSDRSSLFANPDGTQYPAGGPQGTS
GGPGTPGGAGGLGGVGGLGGQPGAGTGGAGAGVGGMGGMGGMPMMPPMMGGGMGGGGGGG
DNNRDRQRSTWLSEDEKVWGTTADAQRSALGRPVPGQSKKGATRHEFADATPDGRGTGTA
SQDDGPAGGRKRKPGGGNRRGRGQEQARGREGERDG
NT seq 3351 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaccagagatcaagtacgaagacctgccggacaagccgctgcacgagctcatg
aacatcttcgccggcaccgacggcgactacaaaccgatggagagcatcgacacggtcacc
aaggacccctgggtcgcggacgggcgctaccacttccatgagaccaccaatcctttcacc
ggcttctcctggaactacggcggccacgagatggaccgctggtggagttacagggagtac
tacacggcgtacacgaccgggtacggcggcggcagctacccctatgagacctacggcatc
gactacgccggctacaccatgcagaagcacctgtggggcgagaagaccctcagcgacggc
aaggaggacctgcacacagacgacacccctcccccgcaggacgggttccggcagcagctg
agcaacctggcgcacctggccgactacgggaacaaccagctgacgtccgagaactgggac
ctcacccggctgcagaagaccatcgacagcctgggcacgctctacgacacactgactccc
tacatcgacggtgagggaggcagtctgaacaagctgtggcaggagatcgacgtccccgac
ggagccatgcagggctcggccgccgcggcgtacaagtaccgcctccaggacatggcgtac
cggatgacctccgtgcacatggagctccccgagttcaaggcggagctggagcgggtcaag
acggtcctgacgttcgccacagccgtcctcgcctacacggtggaccaggccctcaacacc
aggggagggcgcgtccaggaggtactcgacgactggtacttctacacctccgcggggacg
gaggagttcaacccggagcgggaccagttccaggtcacgatcgcctatcccgaggagacc
ggcggggacaaactaaccggtatccccggcgatccgccgacccaggacaacatcaacaac
gtgctctaccagaggttccgcaaccactacgagggcgtctacgaggccgccaaccaggtg
cgcgacctcatggcgcacacctacacgcaggcgcacgccaccataccggtcatcgtggac
cccgctccgctcccgccgccgacccccgagaccggtggcggcggcaacggacccggcggc
gagaaccccttcggagactgggagattgacaaccccttcggagactgggaaatcgacaac
cccttcggagactgggacaacgagggaggcggtccgcccccgccgccgccaccgcccccg
ccgccaccgcagctcccgtacaacggccccggaaccggtggtcagggccccggaaacgaa
gagttcctgcccccgccgcctccgccgaacctcgggctcaacgggcccggcacaggcaac
cccgagggcctgggcggtccgccacctcccaccccggacctgggcctcaacgggcccggc
ttcgatcagctgggcaacaacagcctcgtgcccccgccgcctcccaacgacctgggcctc
aacggccccggcttgggccaggggggcaacaacggttccttcgtgcccccgccgcctccc
aacgacctgggcctcaacggccccggcttgggccaggggggcaacaacggttccttcgtg
cccccaccgccccccaacgacctcggcctcaacggccccggcttcggcagcggcggaggc
aacgaccccggcacgaacgggcccttcatcccgccgcctccgcctccgaacctcggcctc
aacggcccgggaagcggccgcgggggctacaacggctccctggaacgcgatccggcgacg
gggctcccgatcaaccccgagaccggccaacccttccccgtcgaccccgagaccggactg
ccctacaaccccgacaccgggctgcccatcaactacgaccccgagaccgggcgggccctg
cccatcgaccccgtcaccggagaaccggtccccatcggggagaggggcagctccctggag
ttcgacccggccacagggctcccgatcaaccccgagaccggccaacccttccccgtcgac
cccgagaccggactgccctacaaccccgacaccgggctgcccatcaactacgaccccgag
accgggcaggccctgcccatcgaccccgtcaccgggctgcccatcaactacgacccccag
accgggcaggccctgcccatcgaccccgtcaccggagaaccggtccccatcggggagagg
ggcagctccctggagttcgacccggccacagggctcccgatcaaccccgagaccggccaa
cccttccccgtcgaccccgagaccggactgccctacaaccccgagaccgaactgcccatc
aactacgaccccgagaccgggcaggtcctgcccatcgaccccgtcaccgggcagccggtc
ggtatcgacccggtcaccgggctgcccaccgactacgactacgggttgcagccgcccctg
ccgccgcccgacctcggcctcaacggcccaggcacctccgacgactacgactacgggctg
cggccgccgccgctgccggaggacctgggcctcaacggcccggggtcgggcagcgacgta
ccgatcaacccgatcaccggcgagccctacgtcatcgaccccatgaccggtcggccctac
ccgatcaaccccgagaccggggagccgatcaggagcaactacacgggcccgggacaggag
cccccggacgtcctgccgccgccgctggcccccgacgaccgcggcctcaactacggcggt
ctcagcccgagcccctactccagcgacggacccggcgctccggacagctccgaccgctcc
tcgctgttcgccaaccccgacggcacccagtacccggcgggcggcccccaggggacctcc
ggcggaccgggcactccgggcggcgccggcgggctcggcggcgtgggagggctgggcggc
cagcccggcgcgggcaccggcggcgcgggcgccggagtcggcggcatgggaggcatgggc
ggcatgccgatgatgccccccatgatgggcggcggcatgggcggtggcggtggcggcggc
gacaacaaccgcgaccgccagcgctccacctggctctccgaggacgagaaggtctgggga
accaccgccgacgcgcagagatccgcactgggacgccccgtacccggtcagagcaagaag
ggagccacccggcatgagttcgcagatgcaacgccagatggaagaggaactggcacagct
tcacaagacgatgggcctgctggcggacgcaagcgcaaacctggaggcggcaaccgaaga
ggtcgtggccaagaacaggctcgtgggcgcgaaggtgaacgcgacgggtga

DBGET integrated database retrieval system