KEGG   Nocardiopsis dassonvillei: Ndas_3669Help
Entry
Ndas_3669         CDS       T01248                                 

Definition
(GenBank) aminotransferase class-III
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
nda  Nocardiopsis dassonvillei
Pathway
nda00250  Alanine, aspartate and glutamate metabolism
nda00410  beta-Alanine metabolism
nda00640  Propanoate metabolism
nda00650  Butanoate metabolism
nda01100  Metabolic pathways
nda01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Ndas_3669
   00650 Butanoate metabolism
    Ndas_3669
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ndas_3669
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Ndas_3669
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nda01007]
    Ndas_3669
Enzymes [BR:nda01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Ndas_3669
Amino acid related enzymes [BR:nda01007]
 Aminotransferase (transaminase)
  Class III
   Ndas_3669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ADH69067
UniProt: D7B546
LinkDB All DBs
Position
1:4404795..4406126
Genome map
AA seq 443 aa AA seqDB search
MLVLAKSGARGETGGMSELLSRHRAVMPSWLPLYYESPLEITGGKGARVTDADGNTYLDF
FTGIVTNMLGYDVAEVREAVERQIARGVVHTSTLYLIRSQVELAEKIARLSGIPDAKVFF
TNSGTEANETALLLATYARGSDEVLAMRGSYHGRSFGTVAVTGNRAWKNSSLSPLNVHYL
HGTDHAAPAFRGMTDREYVDACVADLRDVLDTTAPNVACLIAEPVQGVGGFAMPPDGLYA
AYKEVLDEHGILFVSDEVQTGWGRTGTSFFGIGNHGVVPDAMTFAKGLGNGFAVGGVVAR
GDLMDRLGALGVATFGGNPVSMAAAGATLDYVLEHDLQGNARRQGALILEGLSALTSLPS
VRDVRGKGLMFAVEMMDPATGAPSSPLAGRVLEATRERGLLVGKGGVHGNVLRMAPPMTL
SREEAVEGRDVLLDAVRTVDAGA
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgctggtcctggccaagtccggtgctcggggcgagactgggggcatgtcggaacttctc
tcacgccaccgcgcggtcatgccctcctggcttcccctgtactacgagtccccgctggag
atcaccggcggcaagggcgcccgtgtcacggacgccgacggaaacacctacctggacttc
ttcaccggcatcgtgaccaacatgctcggctacgacgtggcggaggtgcgcgaggccgtc
gagcgccagatcgccaggggggtcgtgcacacctccaccctctacctcatccgcagccag
gtggagctggcggagaagatcgcccgcctgtcgggcatcccggacgcgaaggtgttcttc
accaactccggcaccgaggccaacgagaccgccctgctgctggccacgtacgcgcgcggc
agcgacgaggtgctggcgatgcgcggcagctaccacgggcgctcgttcggcacggtggcc
gtgaccggcaaccgggcgtggaagaactcctccctgtcgccgctgaacgtgcactacctg
cacggcaccgaccacgcggccccggccttccgggggatgaccgaccgggagtacgtcgat
gcgtgcgtggccgacctgcgcgacgtgctggacaccacggcgccgaacgtggcgtgcctg
atcgccgagcccgtgcagggtgtgggcgggttcgcgatgcctccggacggcctgtacgcc
gcctacaaggaggtgctggacgagcacggcatcctgttcgtgtccgacgaggtgcagacc
ggctgggggcgcacgggcacgagcttcttcggcatcggcaaccacggggtggtcccggac
gccatgaccttcgccaagggcctgggcaacgggttcgccgtgggcggtgtggtggcgcgc
ggcgacctgatggaccggctgggcgcgctgggcgtggccacgttcggcggcaacccggtg
tcgatggcggcggcgggggcgaccctggactacgtgttggagcacgacctccagggcaac
gcgcggcggcagggcgcgctgatcctggaggggctcagcgcgctgacctcgctgccgagc
gtgcgcgacgtgcgcggcaaggggctgatgttcgccgtggagatgatggaccccgccacc
ggagcgccgtcctcacccctggccgggcgggtgctggaggccacccgtgagcgcggcctg
ctggtgggcaagggcggcgtgcacggcaacgtgctgcggatggcgccgccgatgacgctg
tcgcgggaggaggccgtggagggccgcgacgtgctgctggacgcggtgcgcacggtggac
gccggggcctga

DBGET integrated database retrieval system