KEGG   Nocardiopsis dassonvillei: Ndas_3960Help
Entry
Ndas_3960         CDS       T01248                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
nda  Nocardiopsis dassonvillei
Pathway
nda00020  Citrate cycle (TCA cycle)
nda00480  Glutathione metabolism
nda01100  Metabolic pathways
nda01110  Biosynthesis of secondary metabolites
nda01120  Microbial metabolism in diverse environments
nda01130  Biosynthesis of antibiotics
nda01200  Carbon metabolism
nda01210  2-Oxocarboxylic acid metabolism
nda01230  Biosynthesis of amino acids
Module
nda_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nda_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:nda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ndas_3960
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Ndas_3960
Enzymes [BR:nda01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Ndas_3960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: ADH69357
UniProt: D7B6S0
LinkDB All DBs
Position
1:complement(4736119..4737336)
Genome map
AA seq 405 aa AA seqDB search
MAKIKVENPVVELDGDEMTRIIWSFIKDRLILPYLDVDLKYYDLGIEERDRTDDQITVDA
ANAIKEHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVVFREPIICENVPRL
VPGWTKPIIIGRHAHGDQYKATDFKVPGPGTVTMTYTPADGSEPVEFDIANFPEAGGVAM
GMYNFRKSIEDFARASLNYGLDRNYPVYMSTKNTILKAYDGMFKDVFQEIFETEFKDRFD
SAGLTYEHRLIDDMVAAALKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLRTADG
RTVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTRGLEHRGKLDNTPKVVEFANTLE
DVVIKTVEGGQMTKDLALLVGGDQEFLTTEQFLAALDENLAKRLA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggccaagatcaaggtcgagaaccccgtagtcgagctcgacggcgacgagatgacccgg
atcatctggtccttcatcaaggaccgtctgatcctcccctacctcgacgtcgacctgaag
tactacgacctgggcatcgaggagcgcgaccgcaccgacgaccagatcaccgtcgacgcg
gccaacgccatcaaggagcacggcgtcggcgtcaagtgcgccaccatcaccccggacgag
gcccgggtcgaggagttcggcctcaagaagatgtggcggtcgcccaacggcaccatccgc
aacatcctcggcggcgtcgtcttccgcgagcccatcatctgcgagaacgtcccccgcctg
gtcccgggctggaccaagccgatcatcatcggccgccacgcgcacggcgaccagtacaag
gccaccgacttcaaggtgcccggccccggcacggtcaccatgacctacaccccggccgac
ggtagcgagccggtcgagttcgacatcgcgaacttccccgaggcgggcggcgtcgcgatg
ggcatgtacaacttccgcaagtccatcgaggacttcgcgcgcgcgagcctgaactacggc
ctggaccgcaactacccggtctacatgtccaccaagaacacgatcctcaaggcctacgac
ggcatgttcaaggacgtgttccaggagatcttcgagaccgagttcaaggaccgcttcgac
tccgcgggcctgacctacgagcaccgcctcatcgacgacatggtcgccgcggcgctcaag
tgggagggcggctacgtctgggcctgcaagaactacgacggtgacgtgcagtccgacacc
gtcgcccagggcttcggctccctcggcctgatgacctccgtcctgcgcaccgcggacggc
cgcacggtcgaggccgaggccgcccacggcacggtgacccgccactaccgccagcaccag
cagggcaagcccacctccaccaacccgatcgcctccatcttcgcgtggacccgcggcctg
gagcaccggggcaagctcgacaacacccccaaggtcgtcgagttcgccaacaccctggag
gacgtcgtcatcaagaccgtcgagggcggccagatgaccaaggacctcgcgctgctcgtc
ggcggcgaccaggagttcctgaccacggagcagttcctcgccgccctggacgagaacctc
gccaagcgcctggcctga

DBGET integrated database retrieval system