KEGG   Nocardiopsis dassonvillei: Ndas_3998Help
Entry
Ndas_3998         CDS       T01248                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
Organism
nda  Nocardiopsis dassonvillei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Shikimate_DH 3HCDH_N TrkA_N FAD_binding_3 NAD_binding_8 Pyr_redox ApbA Pyr_redox_2 NAD_binding_2 NAD_binding_7 AlaDh_PNT_C F420_oxidored XdhC_C THF_DHG_CYH_C Prot_ATP_ID_OB UDPG_MGDP_dh_N 2-Hacid_dh_C Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: ADH69395
UniProt: D7B7K0
LinkDB All DBs
Position
1:4781498..4782499
Genome map
AA seq 333 aa AA seqDB search
MRAAIITEPGSVTVGDRPDPHPAADGVVVRVGACGICGTDLHIADGEFPPSPYPLVPGHE
FAGTVTAVGENAPGDLRPGDRVAVDPSLFCGHCEYCRAGRGNLCANWGAIGDTVDGAFAE
YVAVPAANCYRLPDSVSMREGALVEPLSCAVHGVRRIGVETGERFLVVGAGTMGLLLQQL
LQNSGARVTVVDRNTRRLAIATDLGAAATATDASELGDERFDAAVDVTGAPSAIEAAFDS
LRRGGRLLVFGVADEAARVALSPFRIYNDEITVVGSMAVLNSYGAAVDLISSGAVRTAPL
LTDALPLEKFPEALAMMRAGTGVKVQVVPDETA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgccgccatcatcaccgaaccgggctccgtcaccgtgggggaccgccccgacccg
caccccgccgccgacggcgtggtggtccgggtcggcgcctgcgggatctgcgggacggac
ctgcacatcgccgacggggagttcccgcccagcccctacccgctggtgcccgggcacgag
ttcgccggaacggtcacggccgtcggcgagaacgccccgggggacctgcgccccggcgac
cgggtggccgtggacccctccctgttctgcgggcactgcgagtactgccgcgccggacgg
ggcaacctgtgcgccaactggggcgcgatcggcgacaccgtggacggcgcgttcgccgag
tacgtggccgtccccgccgccaactgctaccgcctgcccgactcggtgagcatgcgcgag
ggcgccctggtcgagccgctctcgtgcgccgtccacggtgtccggcgcatcggggtggag
accggcgagcgcttcctggtggtgggcgccgggaccatgggcctgctcctccagcagctg
ttgcagaactccggcgcccgcgtgacggtggtggaccgcaacacccgccgcctggccatc
gcgaccgacctcggcgccgccgcgaccgcgacggacgcgtccgagctgggcgacgagcgc
ttcgacgccgcggtggacgtcacgggcgcgccctccgccatcgaggcggccttcgactcg
ctgcggcggggagggcgcctgctggtcttcggggtcgccgacgaggcggcccgcgtggcg
ctgtcgccgtttcggatctacaacgacgagatcaccgtcgtgggctccatggccgtgctc
aacagctacggggcggccgtggacctcatcagcagcggcgcggtgcgcacggcgccgctg
ctcaccgacgccctgcccctggagaagttccccgaggcgctggccatgatgcgcgcgggc
accggggtgaaggtccaggtcgtccccgacgagaccgcctga

DBGET integrated database retrieval system