KEGG   Nocardiopsis dassonvillei: Ndas_4019Help
Entry
Ndas_4019         CDS       T01248                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
nda  Nocardiopsis dassonvillei
Pathway
nda00564  Glycerophospholipid metabolism
nda01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Ndas_4019
Enzymes [BR:nda01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Ndas_4019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored 3HCDH_N NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ADH69416
UniProt: D7B7M1
LinkDB All DBs
Position
1:complement(4808976..4810697)
Genome map
AA seq 573 aa AA seqDB search
MTTTWLGPKGRAETLASMADEELDVLVVGGGIVGAGIALDAVSRGLSTGLVEARDFASGT
SSRSSKLIHGGLRYLEQFDFELVREALHERGLLLTTIAPHLVRPVPFLFPFAHHWERAYI
GAGVTLYDALAMSSRNNRGLPTHRHLTRSGALRVFPALKRSALAGAIQYWDCQVDDARLV
ISVLRTAAGLGAKIASRAQAVGFLREGEHVVGATVADLEGGGERRVRARQVVNAAGVWTD
DIQEMVGGRGQIHVSASKGIHLVVPRDRIQASSGMILRTEKSVLFVIPWGRHWIIGTTDT
AWDLDKENPAASRADIDYVLDHVNQVLRTPLGRDDVEGVYAGLRPLLTGESEETSKLSRE
HTVAHPVPGLVLIAGGKYTTYRVMAKDAVDAVAHGLGNGIPASVTDRLPLVGADGYWALY
NQRHRLARNSGLHVSRVTHLLRRYGASVHDLLDLVRERPDLGRPLAHAEDYLRAEIVYAA
EAEGARHLEDVLSRRTRISFETWDRGIAAAEEAAELLAGPLEWNEEQIGREVEYYRKGIE
AERAAQEQDTDQEADAIQHGAPEIVPEANITRP
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgactaccacctggctgggaccgaaggggcgcgccgagacgctcgcgtcgatggccgac
gaggaactcgacgtcctcgtggtcgggggaggcatcgtcggggcgggcatcgccctggac
gcggtctcgcgcggactgtccacggggctggtcgaggcgcgcgacttcgcgtcgggcacc
tccagccggtccagcaagctcatccacggcggcctgcgctacctggagcagttcgacttc
gagctcgtccgcgaggcgctccacgaacgcggcctgctcctcaccaccatcgccccgcac
ctggtccgcccggtgccgttcctgttcccgttcgcccaccactgggagcgcgcctacatc
ggcgcgggcgtcaccctctacgacgccctcgccatgagctcgcgcaacaaccgcggactg
cccacgcaccgccacctgaccaggtccggggcgctgcgggtcttccccgcgctcaagcgc
agcgccctcgccggggccatccagtactgggactgccaggtggacgacgcccgcctggtc
atcagcgtgctgcgcaccgccgccggcctgggggccaagatcgcctcccgcgcccaggcg
gtcgggttcctgcgcgagggcgagcacgtcgtcggcgccaccgtcgccgacctggagggc
ggcggcgagcggcgcgtccgggcccgccaggtggtcaacgccgccggggtgtggaccgac
gacatccaggagatggtcggcggccggggccagatccacgtcagcgcgtccaagggcatc
cacctcgtggtgccgcgcgaccgcatccaggcctcctccgggatgatcctgcggaccgag
aagagcgtcctgttcgtcatcccgtggggccgccactggatcatcggcaccaccgacacc
gcgtgggacctggacaaggagaaccccgcggcgagccgggccgacatcgactacgtcctc
gaccacgtcaaccaggtcctgcgcacgcccctgggccgggacgacgtcgagggcgtgtac
gcgggtctgcgaccgctgctgacgggggagtcggaggagacctccaagctctcccgcgag
cacacggtggcccatcccgtgcccggcctggtcctcatcgccgggggcaagtacacgacc
taccgggtgatggccaaggacgcggtggacgcggtcgcgcacggcctgggcaacgggatc
ccggcctcggtcaccgaccggctgcccctggtgggcgcggacggctactgggcgctgtac
aaccagcgccaccggctggcccggaactcggggctgcacgtctcccgcgtcacccacctg
ctgcgccgctacggcgcctcggtccacgacctgctcgacctggtccgggagcgccccgac
ctcggccgaccgctcgcgcacgccgaggactacctgcgcgccgagatcgtctacgcggcc
gaggccgagggggcccgccacctggaggacgtcctgtcccggcgcacccggatctccttc
gagacctgggaccggggcatcgccgccgccgaggaggcggccgagctgctcgccggtccg
ctggagtggaacgaggagcagatcgggcgggaggtcgagtactaccgcaaggggatcgag
gccgagcgcgcggcgcaggagcaggacaccgaccaggaggcggacgcgatccagcacggg
gccccggagatcgtcccggaggccaacatcacgcggccctga

DBGET integrated database retrieval system