KEGG   Nocardiopsis dassonvillei: Ndas_4585Help
Entry
Ndas_4585         CDS       T01248                                 

Definition
(GenBank) Catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
nda  Nocardiopsis dassonvillei
Pathway
nda00380  Tryptophan metabolism
nda00630  Glyoxylate and dicarboxylate metabolism
nda01110  Biosynthesis of secondary metabolites
nda01130  Biosynthesis of antibiotics
nda01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Ndas_4585
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    Ndas_4585
Enzymes [BR:nda01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     Ndas_4585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel Catalase_C DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: ADH69972
UniProt: D7AY94
LinkDB All DBs
Position
1:complement(5434411..5436519)
Genome map
AA seq 702 aa AA seqDB search
MSTEGRGGSEGRDAKDRQLDAVRTDSDQPLTTETGVRVGDTDNSLRAGARGPTLLEDFHA
REKITHFDHERIPERVVHARGAGAYGHFRPYEGLSELTAAHFLSGPDVTTPVFVRFSTVA
GSRGSADTVRDVRGFAVKFYTEEGNYDLVGNNMPVFFIQDGVKFPDFVHAVKPEPHNEIP
QAQSAHDTLWDFVGLQPETTHMMMWLMSDRAIPRSYRTMQGFGVHTFRFVSAEGRGTFVK
FHWRPLLGTHSLVWDEAQRVQGKDPDFNRRDLWEAIERGQYPEWELGVQLVPEEDEHAFD
FDLLDATKIIPEEQVPVRPIGKLTLNRNPDNFFAETEQVAFHTANVVPGIDFTNDPLLQA
RNFSYLDTQLLRLGGSNFQQIPINRPVAPVSNNQRDGFAQHRVHRGGTSYHPNSLGGGCP
ALAHGEGVYRHYTEKVEGDKIRVRSESFADHYSQATLFYNSLADWEREHVVEAFRFELGK
CEELEVRQRVVANLNHVDHGLSVRVAEGIGVEPPEREATPNHGRSSPALSQLNTAFGSVV
GRKVAVLVADGVDEAAVDAFREPLIGAGAVVELLAAADGAVRTSRGGVVTVDRAYPTVSS
VLYDAVVVTGGSDAARTLAGDGLARHFVLEAYKHHKPVAAVGAGTELLAPPLPEELTGPV
DALRVELGVVASPDAGEDGVAEFTRLLGGHRFWDRPTASVPA
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
gtgagcactgaaggacgtgggggaagcgaggggcgcgacgccaaggaccgccagctcgac
gcggtcaggaccgactccgaccagcccctgaccaccgagaccggcgtccgggtgggcgac
accgacaactcgctccgggccggggcgcgcggccccacactgctggaggacttccacgcc
cgggagaagatcacccacttcgaccatgagcggatccccgaacgggtggtgcacgcgcgc
ggcgcgggcgcctacggccacttccgcccctacgaggggctctccgagctgaccgcggcc
cacttcctgagcggccccgacgtcaccacgccggtcttcgtccgcttctccacggtcgcc
gggtcgcgcggatccgccgacacggtgcgcgacgtgcgcgggttcgcggtgaagttctac
accgaggagggcaactacgacctcgtcggcaacaacatgccggtcttcttcatccaggac
ggcgtcaagttccccgacttcgtccacgcggtcaagcccgagccccacaacgagatcccc
caggcgcagtccgcgcacgacaccctctgggacttcgtgggcctgcagcccgagaccacg
cacatgatgatgtggctgatgtcggaccgggcgatcccgcgcagctaccggacgatgcag
ggcttcggggtccacacgttccggttcgtcagcgccgagggccgcggcaccttcgtcaag
ttccactggaggcccctgctcggcacgcactcgctggtctgggacgaggcgcagcgcgtc
cagggcaaggaccccgacttcaaccggcgcgacctgtgggaggccatcgaacgcggccag
taccccgagtgggagctgggcgtgcagctggtgccggaggaggacgagcacgccttcgac
ttcgacctgctggacgccaccaagatcatccccgaggagcaggtcccggtccggccgatc
ggaaagctgaccctgaaccggaacccggacaacttcttcgcggagacggagcaggtggcc
ttccacaccgccaacgtggtcccgggcatcgacttcaccaacgatccgctgctccaggcc
cgcaacttctcctacctggacacccagctgctgcgcctcggcggctccaacttccagcag
atcccgatcaaccgtccggtggccccggtgagcaacaaccagcgggacggcttcgcccag
caccgcgtgcaccggggcgggacctcctaccaccccaacagcctgggcggcggctgcccg
gccctggcgcacggggagggcgtctaccgccactacacggagaaggtcgagggcgacaag
atccgggtgcgcagcgagagcttcgccgaccactactcccaggccacgctcttctacaac
agcctcgccgactgggagcgcgagcacgtggtggaggccttccgcttcgagctgggcaag
tgcgaggagctggaggtgcgccagcgggtggtggccaacctcaaccacgtggaccacggg
ctgtccgtccgggtcgcggaggggatcggcgtcgagccgccggagcgggaggccacgccc
aaccacggccgctcctcgcccgccctgagccagctcaacaccgcgttcggctccgtcgtc
ggccgcaaggtggccgtcctggtcgcggacggcgtggacgaggccgccgtcgacgcgttc
cgcgagcccctgatcggggccggtgccgtggtcgaactcctcgcggccgccgacggcgcg
gtccgcacctcgcggggcggcgtcgtcaccgtcgaccgggcctacccgaccgtctcctcg
gtgctctacgacgcggtcgtggtgaccggcggttccgacgccgcacggacgctggcgggc
gacgggctcgcgcggcacttcgtgctggaggcgtacaagcaccacaagccggtggccgcg
gtcggcgcggggacggagctgctcgccccgccgctgccggaggagctgaccgggcccgtg
gacgccctgcgggtggaactgggcgtggtcgcctcgccggacgcgggtgaggacggcgtc
gccgagttcacgaggctgctgggcgggcaccggttctgggaccggccgacggcgtccgtg
cccgcctga

DBGET integrated database retrieval system