KEGG   Nocardiopsis dassonvillei: Ndas_4989Help
Entry
Ndas_4989         CDS       T01248                                 

Definition
(GenBank) GCN5-related N-acetyltransferase
  KO
K00619  amino-acid N-acetyltransferase [EC:2.3.1.1]
Organism
nda  Nocardiopsis dassonvillei
Pathway
nda00220  Arginine biosynthesis
nda01100  Metabolic pathways
nda01110  Biosynthesis of secondary metabolites
nda01130  Biosynthesis of antibiotics
nda01210  2-Oxocarboxylic acid metabolism
nda01230  Biosynthesis of amino acids
Module
nda_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:nda00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Ndas_4989
Enzymes [BR:nda01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     Ndas_4989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_CG Acetyltransf_10 Acetyltransf_9 NodA
Motif
Other DBs
NCBI-ProteinID: ADH70371
UniProt: D7B863
LinkDB All DBs
Position
2:130219..130857
Genome map
AA seq 212 aa AA seqDB search
MPVRHVHVRRARTRDVAAVRRLVDAYTVDRRVLSKSTVNLYEDVQEFWVAEAEVVPDGSG
PASPHAAPPPDAPAPGAERADPPDAGAEYRVVGCGALHVLWEDLAEVRTVAVDPSLRGFG
VGHRIVSALLDTARELGVRRVFCLTFETGFFAKHGFARIQGTPVSPRVYEELLRSYDEGV
AEFLDLERVKPNTLGNTRMLVHLDAATRTTRT
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgcccgttcgccatgttcacgtgcgccgcgccaggacgcgcgacgtcgccgccgtccga
cgcctcgtcgacgcctacaccgtcgaccggcgcgtgctctccaagagcaccgtcaacctc
tacgaggacgtccaggagttctgggtggccgaggccgaggtggtccccgacggctccggc
cccgcctccccgcacgccgcgccccctcccgacgcccccgcgcccggagcggagcgcgcc
gatcctcccgacgccggggccgagtaccgcgtggtgggctgcggagcgctgcacgtgctc
tgggaggacctggcggaggtgcgcaccgtcgccgtggacccctccctgcgcgggttcggc
gtcggacaccggatcgtgtccgcgctgctggacaccgcacgggagttgggcgtgcgccgt
gtgttctgcctgacattcgagaccggtttcttcgccaaacacggctttgcccggatccag
ggcacgccggtctccccccgtgtgtacgaggaactcctgcgttcctatgacgagggcgtc
gccgaatttctcgacttggagcgggttaagcccaacaccctcgggaacacccgcatgctt
gtgcacctcgacgcggcaacgcgaaccacccggacctaa

DBGET integrated database retrieval system