KEGG   Nitrospira defluvii: NIDE2150Help
Entry
NIDE2150          CDS       T01281                                 

Definition
(GenBank) putative Multi-domain non-ribosomal peptide synthetase
Organism
nde  Nitrospira defluvii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C_2 Methyltransf_25 Dcc1 DUF2271
Motif
Other DBs
NCBI-ProteinID: CBK41870
UniProt: D8PF61
LinkDB All DBs
Position
2054653..2060376
Genome map
AA seq 1907 aa AA seqDB search
MLRNACQYQTLVELLRVRVSEAPTKHAYTYLRDGETDALTWNYGELDRRARAIAAWLQSC
GAAGERALLLYPPGLDYLAAFFGCLYAGVVAVPAYPPQRQRGWPRVRAMLADSQAAYALT
TSGIARAIDRLSAKEDGYGRLATLQWLNTDHVPSGIDEDWSEPDITPETLAFLQYTSGST
ALPKGVMVSHANLVHNQRLIQAAFGHTSQDVIVGWLPLYHDMGLIGNVLQPLHLGASCIL
MSPVHFLQKPVRWLSAITRYRATTSGGPNFSYDLCVRQITAAQRELLDLSSWTLAFNGAE
PVRAETIERFSDRFRDRGFRKEAFYPCYGLAEATLLVSGGTRGTGPLVQPFEYSRLSSEP
TASASGAASHLLVSCGVDRSGRQIRIVHPDSGIACAEGQVGEIWVSGPCVAQGYWQREQE
SRETFQTSLGGTGEGPFLRTGDLGFLKDGELFVTGRLKDLIIIRGRNHYPHDIERTIEEC
HPGLRPGAGAAFAITEGDEEQLVVVQEVEPRSQALDLQAITTAIRQTVAQAHEVSVCAVV
LIKAGTLPKTSSGKVQRSLCREKFLARELIAVEESVLRNSTAAVVLEEDPALAGDEGGLE
QELVDIWSQVLSRPNIKSGDDFFALGGDSLRGLQVVARVREVRGLNVPLDALFDYPTLAA
FSAHVATCVPAEPGSPIKSIRRVSRDETLPLSFAQERFWFLDQLSPGSSINNIPVALRLV
GSLDVEALRRSLDEIVQRHEILRARFALRNGRPSHIMVPKLTLALEVEDLRRSVEAGGDE
LVLRLVREEACRPFDLAKGPLVRGRLFRLDTMNHVLSLTLHHIVADGWSMDVLRRELASL
YESFKNHRPSPLPALPIQYVDLIAAQLEQAKGENDRRLLEYWVDQLEGAPPLLNLPWDYP
RPAIQGHRGARHPWTVEPELAHRLYEAGARYRATPFMLLVSALGLLLSRYSRQTDFCIGT
PVANRVGREAGQLVGCFVNTVALRMDVSGNPSWPALLDRVREMVLGAQSHQDLSFERLVD
ELGVVRDLGHTPLFQVMFVLEDSPSDVRRFADLEASRLNVGTGTSVFDLTLEMAQKTDGS
LDAVFEYSTDLFAADTIARMAGHLQALLQQIVASPEASVSELSILSPGEQALELADSRSP
REAYLQEASLHHLIEAQASKTPDAVALQCDRGPVTYDSLNRLGNQLARYLRVQGIVHEVP
VALCVDRSLEMAVGILGCLKAGATYVPVDPSYPTERQAAIFRDAQPQLVLTQGRYLESLP
EHTAPVLALDVEWPAVAGLPDDNLVTGSNPDRLAYLLYTSGTTGIPKGIGITHRALVNHG
LAMVRAYDLSPADRVLQFASVSFDVAAEECFPTWLAGATVVLRANEPVPAYGDFQAFVHA
QGVTVVNLPTPYWAAWAEESERIGAAIPSSLRLVIVGSEKALPDDLRRWRRTAGERVDWC
NSYGPTEATITASTYRPGPAQDDTTLRTIPIGRPIANVEMYVLDRHLHPVPAGVPGDLYI
GGPGLARGYHRRPALTAAQFIPHPFSHDRGARLYRTGDVARRRSDGHLEFLGRADEQVKI
RGFRVEPQEIECHVRAHPAVKDARVFLESEAPGDWSAVLAGLSDEEQDRLVRDVEALSAA
EARWLYDLESDGEQRRKTVIQRKPEFEVYLKINKEEFLTPPRANQRNWLLRRALDEFSDD
LLALDEASKRFVSGSDRADIERGWAESRAEYNPSELIIEGQQVMQDWEAPLMKAMADIVT
DGHGDVLEVGFGMGISASYIQAGRPSSHTIIECNRDVMRAFAEWTDKYPDRDIRLVQGRW
QDVVEDIGLFDGVFFDTYPASEAEFEESVINSINFAEGFIPVAAKLLRPGGVFTYYTNEI
DSFSRRHQRFLLDHFGSFTLSIVRSLLPPDDCHYWWADSMAVVKAVK
NT seq 5724 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcaacgcttgtcaatatcagacactcgtcgaactccttcgtgtgcgggtgtcg
gaggccccaaccaaacatgcgtatacgtatcttcgcgatggtgagacggatgcgctgacg
tggaattatggcgagttggatcgccgcgccagggccatcgctgcgtggttgcagtcgtgt
ggtgcggcaggggagcgggcgctgttgctctacccgccggggctcgactatctggccgcg
tttttcggttgtctctatgccggagtggtggccgtgccggcctacccgccgcagcggcaa
cgcggctggccgagagttcgagcgatgcttgcagattcgcaggccgcctacgcattaacg
acgagcggcatcgcgcgggcgatcgaccggctttccgccaaagaggacgggtacgggcgt
ctggcgacgctccagtggctcaatactgaccatgtgccgtcgggtatcgacgaagattgg
agtgagccggacattacgccggagacgttggcgtttctgcaatatacctccggctcaacc
gctcttccaaagggcgtgatggtcagtcatgccaatctggtgcataaccagcggctgatt
caggcggccttcggccatacgtcgcaagatgtcatcgtcggctggctgccgctgtatcac
gacatgggattgatcggcaatgtgttgcaacctctccatctcggcgcctcctgcatcttg
atgtctccagttcattttctgcagaagccggtacgctggctgtcggcgatcacgcggtac
cgcgcgacgaccagcggagggccgaatttctcgtatgacctctgtgtgcggcagattacc
gcggcgcagcgggaattgctggatttgagttcgtggaccctggccttcaacggtgccgaa
cccgttcgcgccgagacgatcgaacggttctcggataggtttcgagatcgtggattccgc
aaggaggccttttatccctgttatgggttggccgaggcgacgctgctggtctcgggtgga
acccgtggaacgggaccactcgtgcagccgtttgagtactcccgactctcgtctgagccg
acggcgtctgcctccggtgcggcaagccatctcctggtgagttgcggtgtcgaccgatca
gggcggcagatccgcatcgtccatcccgactccggaatcgcctgtgccgagggtcaggtg
ggagagatttgggtgagcggcccttgcgtcgcgcaggggtattggcagagggaacaggag
tcccgggagacctttcagacatcacttggcgggacaggagaggggcccttcctccggacc
ggagatctcggattcctcaaagacggggaactgttcgttaccggcagattgaaagacctc
atcatcatccggggccgcaatcactacccgcatgacatcgaacggacgatcgaggagtgc
catccgggactcaggcctggtgccggagcggcgttcgcgatcactgaaggggacgaagag
caacttgtggtggtgcaggaggtggaaccgcgctcacaggccctcgatctgcaagcgatc
accaccgccatccgacagacggtggcgcaggcgcatgaggtgtcggtttgtgcagtggtg
ctcatcaaggccgggacgcttccgaaaacctcgagcggaaaggttcagcgaagtctgtgc
cgtgagaaatttctcgcccgtgaattgatcgcggtcgaagagtcggtgctgaggaattcc
accgcagcagtcgttctggaggaggatcctgcactagccggggatgagggcggcctcgag
caggagctggtagacatctggtctcaggtattgagccggcccaacatcaagtcgggcgat
gatttcttcgccctgggcggcgactccttgcgcgggcttcaggtggtcgcacgggtgcga
gaggtccgcggactcaatgttcccttggacgcgctgttcgattatccgacgcttgccgcc
ttctcggctcatgtcgcgacctgtgtacccgccgagcccggttccccgatcaaatcgatc
cggcgggtatcacgcgacgaaacactgccactctccttcgctcaagaacgattttggttt
ctggaccagttgtctccaggcagttcgatcaacaacattccggtcgccttgcggctcgtc
ggttccctcgacgtggaggcattacgccgctcgctggatgaaatcgttcagcgccacgag
atccttcgcgcaaggttcgcgctgcgcaacggccgtccctcacacatcatggtgcccaaa
cttaccctcgctctggaggtcgaagacctgcgcaggtcggttgaggccggcggggatgag
ctggtcctgcgtttggttagagaagaagcctgccgcccgttcgatcttgccaaaggaccg
ctcgttcgcggccggctcttccggctcgacaccatgaatcatgtgctgtcgctgaccctg
catcacatcgtggcggacgggtggtcgatggatgtgctcaggcgggaattggcttcactg
tatgagtcgttcaagaaccatcgtccgtcacctctgccggcgctccccatccagtatgtc
gatctgattgccgctcaattggaacaagccaagggtgaaaatgatcgacgactgcttgaa
tattgggtcgatcaactggagggagcgcctccgctgctcaacctgccctgggactatccg
cggccggccatccagggtcatcgaggcgctcgtcatccgtggacggtggaaccggagctc
gcgcatcgcctgtatgaagcgggggcccgctaccgcgcgacgccgttcatgttgttggtc
tctgccctcggtctcctcttgtctcggtatagccgccagaccgatttctgcatcggcacc
ccggtagccaaccgcgtgggccgcgaagcgggacaactggtgggctgttttgtcaacacc
gtcgcgctccggatggatgtgtccggcaacccctcgtggccggctctgctggatcgtgtt
cgcgagatggtgctcggggcgcagagccatcaggacctgtcctttgagcgtttggtcgac
gaactaggtgtggtgcgggacctcggccacacgccgctgtttcaggtgatgttcgtgctg
gaggatagcccctcggacgtccgtcggttcgcggaccttgaggcttcccggttgaacgtc
ggcacggggacctccgtcttcgatctcacgctggagatggcacagaagaccgatggaagc
ctggatgcggtcttcgaatacagtacggatctctttgccgcagacacgatcgcgcggatg
gccgggcatctgcaagcactgttgcaacagatcgtcgcctcgccggaggcatccgtgagt
gagttgtcgatcctctcgcccggcgagcaggctttggagcttgccgatagtcgcagtcca
cgggaggcctatctgcaggaagcctcgctccatcacctgatagaagcgcaggcgagtaag
acaccggatgcggttgcgctccaatgcgaccgaggccccgtcacctatgactcgttgaac
cgcctgggcaaccaactcgcccgctatctgcgagtgcaggggatcgtccatgaggtgcct
gtcgcactttgcgtagaccgctcgctggagatggccgtcggtatcctgggctgtctcaaa
gccggcgcgacctacgtaccggtcgatccttcctatcctactgaacggcaggcggccatt
ttcagggatgcgcagcctcagcttgtgttgacccagggaagatatcttgaaagccttccc
gagcacaccgcgccggttttggcgcttgatgtcgaatggccggctgtcgccggtttgcct
gacgataatcttgtcaccggctcgaatcccgaccgccttgcgtatctgctttatacgtcc
ggcaccacagggattcccaagggcatcggaatcacacaccgggccttggtgaatcacggc
cttgcaatggtccgggcctatgacctgtcgccggcggatcgcgtgttgcagtttgcctcg
gtgagttttgacgtcgcggcagaagaatgtttccccacctggctggccggggcgacagtc
gttctgcgtgccaacgagccggttccagcctacggggatttccaggccttcgtgcatgcg
cagggggtgacggtggtgaacctgccgactccctattgggccgcttgggctgaagagagt
gagcgcatcggtgcggccattccgtcgtcgctcagactggtcatcgtaggaagcgaaaaa
gcgttgccggacgacctccggcggtggcgacggacagccggcgagcgggttgattggtgc
aactcctatgggccgacggaagccacgatcaccgcgagtacctaccggcctggaccagcg
caggatgatacgaccttgcgaaccattccaatcgggcggccgatcgccaacgtggagatg
tatgtcctggatcgccatctccacccggtgccggccggtgttcccggcgacttgtatatc
ggcggcccaggcctcgcgcgaggctaccatcggcgaccggcgctgaccgccgcacaattt
attccccatccctttagtcatgacaggggggcgcgtctgtatcgcaccggcgatgtagcc
cgccgtcgttcggacggacatctcgaatttctcgggcgtgcagatgagcaggtcaagatt
cgcgggttccgcgtggaaccgcaggagatcgaatgccacgtgcgcgcccatcccgcggtc
aaagacgcacgggtatttctggaatccgaggctccaggcgattggagcgcggttctggcg
ggtctcagtgacgaggagcaagaccggctagtgcgggacgtggaagccctgtcggctgcc
gaagcgcgctggttgtacgacctggagtcggatggagaacaacggaggaagacggtgatt
caacggaagccggagttcgaggtgtatctcaagatcaacaaggaagagtttttgacgcct
ccacgcgccaaccaacggaattggttgctgcgccgcgccctcgatgagttctcggatgat
ctgttggctctcgatgaggcgtcgaaacgcttcgtctcaggatcggatcgggccgacatc
gaacgcggctgggccgagagccgggcggagtacaacccgtcggaactcatcatcgaaggg
cagcaggtgatgcaggattgggaagcgccgctgatgaaggccatggccgacatcgtaacc
gacgggcacggcgatgtgcttgaggtggggttcggcatggggatctcggcgtcgtacatt
caggcgggccggcccagctcgcataccatcatcgagtgtaaccgggatgtcatgcgcgcc
ttcgcggagtggacggacaagtacccggatcgcgacatcaggctcgtgcagggacggtgg
caggatgtcgtggaggacatcggcctgttcgacggcgtgttcttcgatacctacccggcc
agcgaggcagaattcgaagagtccgtcatcaatagcatcaatttcgccgaagggttcatt
ccggtggccgccaagcttctgcgtccgggcggcgtcttcacgtactacaccaacgagatc
gattcgttcagccggcgacatcaacgtttcctgctcgatcatttcgggtcgttcaccctg
agcatcgtccggtcgcttctccctccggacgactgccactactggtgggccgactccatg
gcggtcgtcaaggcggtgaagtga

DBGET integrated database retrieval system