KEGG   Nitrospira defluvii: NIDE2469Help
Entry
NIDE2469          CDS       T01281                                 

Gene name
accC
Definition
(GenBank) Acetyl-CoA carboxylase, biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
nde  Nitrospira defluvii
Pathway
nde00061  Fatty acid biosynthesis
nde00620  Pyruvate metabolism
nde00640  Propanoate metabolism
nde01100  Metabolic pathways
nde01110  Biosynthesis of secondary metabolites
nde01120  Microbial metabolism in diverse environments
nde01130  Biosynthesis of antibiotics
nde01200  Carbon metabolism
nde01212  Fatty acid metabolism
Module
nde_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:nde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NIDE2469 (accC)
   00640 Propanoate metabolism
    NIDE2469 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NIDE2469 (accC)
Enzymes [BR:nde01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     NIDE2469 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     NIDE2469 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp RimK ATP-grasp_3 ATPgrasp_ST ATP-grasp_4 ATP-grasp_2 ATP-grasp_5 Oxidored_nitro NAD-GH DUF3182
Motif
Other DBs
NCBI-ProteinID: CBK42179
UniProt: D8PFZ2
LinkDB All DBs
Position
2414697..2416046
Genome map
AA seq 449 aa AA seqDB search
MFKKVLVANRGEIALRVIRACKELGVKTVAIHSEADAASLHVRAADEHVCVGPPEAALSY
RNIPNVLSAAEVTGADAIHPGYGFLSENAHFAEVCESIGVKFIGPTSENIALMGDKSKAR
EVVAKKGLPVTPGSPGELRSEQDAQEAAKTIGFPVIIKASAGGGGRGMRVVNKPEELARA
FQAAQAEAKSTFGHDGVYLERYFLEPRHIEVQIVADNRGHVVHLGERDCSIQRRHQKLVE
ETPSPAIDEELRREIGRVAVQAVKAIRYCNVGTVEFLLDKDRNFFFMEVNTRIQVEHPIT
EMVTGIDLVKEQIRIASGMPLSFKQQDIKLNGHSFECRINAEDPEKFTPCPGQITKYSAP
GGFGVRVDSAMEPNAVVVPYYDSLIAKLITHGRDRQEAMARMRRALDEFVIEGIKTTIPL
HRRIFNDPDFQKGHVSTTFLDRFLAGQSS
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtgtttaagaaagtgttggttgccaatcgtggagaaatcgcccttcgggtgatccgcgcc
tgcaaagagctcggcgtcaaaaccgttgcgattcattccgaagccgatgccgcaagtttg
cacgtgcgggctgcggacgagcacgtctgtgtcggacctccggaagccgccctcagttac
cgcaatatccctaacgtcctgagcgccgccgaagtgaccggggccgatgccattcatccc
ggctatggattcctttcagagaacgcgcactttgcggaagtctgcgaatcgatcggcgtc
aaattcatcggcccgacttctgaaaacatcgccctgatgggcgacaaatcaaaggcacgg
gaagtggtcgctaagaagggcctcccggtcacccccggcagccccggcgaactccggagc
gaacaggatgcgcaagaggccgcgaaaaccatcggctttcccgtgatcattaaggcctcc
gccggaggcggcggacggggcatgcgtgtggtgaacaaaccggaggagctcgcgcgggcg
tttcaagcggcgcaagccgaggcgaaatccaccttcggccacgacggcgtctaccttgag
cgctatttcctcgaaccacggcacatcgaagtacaaatcgtggccgacaatcggggccat
gtggtccacctcggcgagcgtgattgctccattcaacgacgtcaccaaaagctggtggaa
gaaaccccgtcgccggccatcgatgaagaattgcggcgcgaaatcggccgggtggccgtc
caggccgtgaaagccattcgctattgcaacgtcggcacggtggagtttctgctggataag
gaccgcaacttcttcttcatggaagtgaatacccgcatccaggtcgagcaccccatcacg
gaaatggtgaccgggatcgatctcgtgaaagaacagatacggatcgcgtcgggcatgccc
ctctcgttcaagcagcaggacatcaagctgaacggtcacagcttcgagtgccgcatcaat
gccgaagatccggaaaagttcacaccctgtccaggacagatcaccaaatattccgccccc
ggtggcttcggcgtgcgcgtcgattccgcgatggaaccgaacgccgtggtggttccgtac
tacgacagcctgatcgccaaattgattacgcacggacgtgatcgccaggaggccatggcc
cgcatgcgccgcgcactcgatgaatttgtcatcgaaggcatcaaaacgacgatcccgctc
catcggagaatttttaacgatcccgatttccagaaggggcatgtctcgacgacattcctt
gaccgctttcttgccggccagtcctcgtaa

DBGET integrated database retrieval system