KEGG   Nitrospira defluvii: NIDE2756Help
Entry
NIDE2756          CDS       T01281                                 

Gene name
argJ
Definition
(GenBank) Arginine biosynthesis bifunctional protein ArgJ
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
nde  Nitrospira defluvii
Pathway
nde00220  Arginine biosynthesis
nde01100  Metabolic pathways
nde01110  Biosynthesis of secondary metabolites
nde01130  Biosynthesis of antibiotics
nde01210  2-Oxocarboxylic acid metabolism
nde01230  Biosynthesis of amino acids
Module
nde_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:nde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    NIDE2756 (argJ)
Enzymes [BR:nde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     NIDE2756 (argJ)
    2.3.1.35  glutamate N-acetyltransferase
     NIDE2756 (argJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ
Motif
Other DBs
NCBI-ProteinID: CBK42462
UniProt: D8PGS5
LinkDB All DBs
Position
2703433..2704644
Genome map
AA seq 403 aa AA seqDB search
MKIITGGVTAPIGFRAAGMYSGIKKKQKKQLDLALLVSEQEGPIAGVFTTNQVVAAPVVL
DRLHLKKGVGRAILVNSGNANACTGPDGMRVAKEMAQLAATALDCPPHTIFVGSTGVIGQ
PLPIDCIRNAVPLLLARVTRRGGNEAAQAIMTTDLKPKQVAVRARLGGRMVTVGGMAKGS
GMIHPNMATMLGYLTTDAVIGRSALQTALSQAVDQSFNCITVDGDTSTNDTVLLLANGMA
GNQTLKPGSADFRKFCAMVETVCRTLALKICWDGEGVTKVVRVEVVRARSTTAAKQIAQT
IATSNLVKTALFGGDANWGRVMAALGRAGVPIDPALVSLQFGDVPMVRNGQGLGRGAEQK
LTKVFRAKEFTIRVDLAQGKAGAHMWTTDLSYEYVRINASYRS
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcatcactggaggcgtcaccgcacccatcggctttcgggccgccgggatgtat
tccggcatcaagaaaaagcagaagaaacaactcgacttggctctgctggtctccgagcag
gaaggccccatcgccggagtgtttaccaccaatcaggtcgtggcggcaccggttgtactc
gatcgtctccatctgaaaaaaggcgtgggccgcgccatcctcgtcaacagcggaaacgcc
aatgcctgcaccggacctgacggcatgcgagtggccaaggagatggcgcagctggcagcc
acggccctcgactgtccgccgcatacgatcttcgtcggatcgaccggcgtgatcggccag
ccgcttccgatcgactgcatcaggaacgccgtcccgctcctcctcgctcgcgtcacgcgc
cgcggcggaaacgaagcggcccaagccatcatgaccacagacctcaagcccaaacaggtg
gcggtgcgcgcccgactcggaggtcggatggtgacggtcggaggaatggccaagggctcc
ggcatgatccatcccaacatggccaccatgctgggctatctcaccaccgatgcggtcatc
ggccggtccgcccttcagacggcactgagtcaggcggtcgatcaatcatttaactgcatt
accgtcgacggggatacgagcacgaacgacacggtgctcttgctggccaacggaatggcg
ggcaaccagacactcaagcccggctctgcggactttcgaaagttctgcgccatggtcgaa
acggtctgtcgtacccttgccttgaaaatttgctgggacggcgaaggcgtgaccaaggtc
gtgcgggtagaggtcgtgcgcgcccggtccacaacggcagccaaacagatcgcccaaacg
atcgccacctccaacctggtcaagaccgcgctctttggtggtgacgccaactggggccgt
gtgatggcagccctcggacgcgcaggggtacccatcgatccagccctggtcagcctgcaa
tttggggatgtcccgatggtccggaacggccaaggactgggccgcggcgccgagcagaag
ctgaccaaggtcttcagggcgaaagaatttacgattcgtgtcgacctcgcgcagggcaaa
gccggagctcacatgtggacgaccgacttgtcctatgaatacgtgcggatcaacgcgagt
taccggtcgtga

DBGET integrated database retrieval system