KEGG   Nitrospira defluvii: NIDE4183Help
Entry
NIDE4183          CDS       T01281                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
nde  Nitrospira defluvii
Pathway
nde00260  Glycine, serine and threonine metabolism
nde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NIDE4183 (tdh)
Enzymes [BR:nde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     NIDE4183 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C Methyltransf_25 TGBp3 FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-ProteinID: CBK43851
UniProt: D8P8L9
LinkDB All DBs
Position
4130368..4131402
Genome map
AA seq 344 aa AA seqDB search
MRALVKTAAQPGLTYTDRPDPAPGPSEAVIRVKATSLCGTDAHIYNWDAWAHSRIHPPRT
IGHEMCGEVVAVGADVTLVCVGDYVAAESHLTCGACFQCRTGQAHVCKNYRILGVDLDGS
FADYVVLPETVLWKTSPDIPPELACLQEPLGNAVDAALVEDLTGHTVLITGCGPTGLFAA
AVARTAGAATIIATDVSDYRLSLAKQVGVDHVFNAKSDGAEAIASAILDITRGEGVDASL
EMSGHPTALHHAFRSVKNGGRVTLFGIPTGPVTCDLANEVIFKGIRVHGITGRRLFSTWY
RLAGLFKAGLNIRPVLTHTFPLKDFAQGFELIKSGQCGKVVLFP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcactcgtgaagaccgccgctcaaccggggttgacctataccgatcgcccggat
cccgcacccggtccatctgaggccgtcatccgggtcaaggccacgtcgctgtgtggaacc
gatgcccacatctataactgggatgcctgggcccacagccgcattcatcctcccaggacg
atcggacatgaaatgtgcggcgaggtggtggccgtcggggcggatgtcacgctcgtgtgc
gtgggtgactatgtcgcggctgaatcgcacttgacctgcggcgcctgctttcaatgccgc
accggccaggcccatgtgtgcaagaactaccggattctcggcgtcgatctggacggctcg
tttgccgactacgtcgtgctccctgaaaccgtgctttggaaaacatccccggacattccg
ccggagctggcgtgcctacaagaacctttgggcaatgccgtcgatgcggccctggtggaa
gacttgaccggtcacaccgtcctgatcaccggctgcggccccaccggcctgttcgccgcg
gccgtcgcccgcaccgcaggagccgccaccattatcgccaccgatgtcagcgattaccgc
ctgagcctggccaaacaagtgggcgtcgatcacgtattcaacgccaagagcgacggcgcg
gaggccattgcctcagcgattctcgacatcacgaggggagaaggcgtcgatgcgtcgttg
gaaatgtccggacaccccacagccttgcaccacgccttccgctcggtaaaaaacggcggt
cgcgtcacgctgttcggcattcccaccggccccgtcacctgcgacctcgccaacgaggtc
atcttcaaaggcatccgagtccatgggattaccggtcgtcgcctgttcagcacctggtat
cgcctggccggtctcttcaaagccggcctcaatatccgtccggtcctcacccataccttc
cccctcaaagactttgcccaaggatttgaattgatcaaatccggccaatgcggcaaagta
gtcctgtttccatag

DBGET integrated database retrieval system