KEGG   Naumovozyma dairenensis: NDAI_0B03810Help
Entry
NDAI_0B03810      CDS       T02234                                 

Gene name
NDAI0B03810
Definition
(RefSeq) hypothetical protein
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi00020  Citrate cycle (TCA cycle)
ndi00310  Lysine degradation
ndi00380  Tryptophan metabolism
ndi01100  Metabolic pathways
ndi01110  Biosynthesis of secondary metabolites
ndi01130  Biosynthesis of antibiotics
ndi01200  Carbon metabolism
Module
ndi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ndi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NDAI_0B03810 (NDAI0B03810)
  09105 Amino acid metabolism
   00310 Lysine degradation
    NDAI_0B03810 (NDAI0B03810)
   00380 Tryptophan metabolism
    NDAI_0B03810 (NDAI0B03810)
Enzymes [BR:ndi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     NDAI_0B03810 (NDAI0B03810)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 11498280
NCBI-ProteinID: XP_003668658
UniProt: G0W6K4
LinkDB All DBs
Position
2:complement(957317..960361)
Genome map
AA seq 1014 aa AA seqDB search
MLRAITNPVYRKGSRSLVNIALLKQCSNKLTHSSQRYITTGTDTFLSTSNSSYIDEMYLA
WQKDPTSVHVSWDAYFKNMGNLKTPASNAFQAPPIIIGTPQSSPQSPLGSVASNVDANVS
LHLKVQLLCRAYQVRGHLKAHIDPLGLSFGDSSSKHIPKELTLEYYGFNENDLKTEINLG
PGILPRFARKDGQPTKMPLGEIIEHLEKLYCSSYGIQYTHIPSKEKCEWLRERIEIPNPY
KYSVDQKRQILDRLTWATSFETFLSTKFPNEKRFGLEGLEAVVPGIKTLIDRSVEMGVED
VVLGMAHRGRLNVLSNVVRKPNESIFSEFTGTSTRDDIEGSGDVKYHLGMNYQRPTTSGK
YVNLSLVANPSHLEAQDPVVLGRTRALLHAKGDLENKTKALGVLLHGDAAFAGQGVVYET
MGFLTLPEYSTGGTIHIITNNQIGFTTDPRFARSTPYPSDLAKAIDAPIFHCNANDIEAV
TFIFNLAAEWRNTFHTDAIIDVVGWRKHGHNETDQPSFTQPLMYKRIAKQKSVIDVYTAK
LLNEGSFTQKDIDEHKKWVWSLFEEAFEKSKDYVPSQREWLTAAWEDFKSPKELATEILP
HNPTKVPAETLQNIGKVISTWPEKFEVHKNLKRILTNRGKSISEGEGIDWSTGEALAFAT
LTLEGHNVRVSGEDVERGTFSQRHAVLHDQNSEDTYIPLKHLSEKQADFSICNSSLSEYG
VMGFEYGYSLTSPEYLVMWEAQFGDFANTAQVIIDQFIAGGEQKWKQRSGLILSLPHGYD
GQGPEHSSGRLERFLQLANEDPRYFPSEEKLQRQHQDCNFQVVYPTTPANLFHIIRRQQH
RQFRKPLALFFSKQLLRHPLARSNLEEFTEGGFQWIIEDVEHGKAIGTKEETKRLVLLSG
QVYTALHKKRETLGDKTTALMKIEELHPFPFAQLRDAINSYPNLEEIVWCQEEPLNMGSW
SFVSPRLKTTLNETTYKDFTVRYCGRNPSGAVAAGSKALHAAEEEAFLKDVFQQ
NT seq 3045 nt NT seq  +upstreamnt  +downstreamnt
atgttaagagctataacaaatccggtatataggaaaggctcacgatcattagtgaatatt
gctcttctcaagcaatgttccaacaaactaactcactcttctcaaaggtatattacaact
ggaacagatacattcctttccacttccaactcctcttacatagatgaaatgtatttagca
tggcaaaaggatcccacctcagtccacgtctcttgggatgcatatttcaaaaatatgggt
aatttgaaaactccagcttcaaatgcattccaagctcctccaatcataattggaactcct
caatcttctccacaatctccattaggatctgtagcaagtaatgtggacgcaaacgttagc
ttacatctaaaggtacaattactatgcagagcatatcaagttagaggtcatttgaaagct
catattgatccattgggattatcatttggtgatagctcctctaaacatatccctaaagaa
ttaactttggaatattacggattcaatgaaaatgatttgaagacagagattaatttggga
ccaggaatattacctagattcgctaggaaagatggtcaacccactaagatgccattaggt
gaaattattgaacatttggaaaaattgtattgttcctcgtatgggatccaatatactcat
attccatcaaaggagaaatgcgaatggttaagggaaagaattgaaattccaaatccttat
aaatatagtgtagatcaaaagagacaaattttagataggttgacttgggcaacttctttt
gagactttcttatctactaaattccccaatgagaaaagatttggtttagaaggtttagag
gctgtggtgcctggtattaagactttgattgatcgttccgtggaaatgggtgtcgaagat
gtagtcttaggtatggctcatcgtggtagattgaatgtcttatctaatgtggttcgtaaa
cctaatgaatctatcttttcagagtttactggtacaagtacaagagatgacattgaaggg
tccggtgatgttaaatatcatttgggtatgaattatcaaagaccaacaacttctggtaaa
tatgtgaacttatcattagtcgctaatccatctcatttagaagcacaagatccggttgta
ttaggtagaacaagagcattattacatgctaaaggtgatttagaaaataaaactaaggca
ttaggtgtcttattacatggtgatgctgcatttgcaggtcaaggtgttgtttatgaaaca
atgggattcttaacattaccagaatattctacaggtggtaccatccatattattaccaat
aatcaaatcgggttcacaacagatccaagatttgcaagatctacaccatatccctcagat
ttagctaaggctattgatgcaccaattttccattgtaatgcaaacgatattgaagctgtt
acatttattttcaacttagctgctgaatggagaaataccttccatactgacgctatcatc
gatgttgtgggttggagaaaacatggtcataatgaaactgatcagccttctttcacccaa
ccattaatgtataagagaatcgctaagcaaaaatcagttattgatgtatatactgcaaaa
ttgttaaatgaaggatctttcacacagaaggatatcgatgaacataagaaatgggtttgg
agtctttttgaagaagcatttgagaagagtaaagactatgttccgtctcaaagagaatgg
ttaacggctgcttgggaagactttaagtcaccaaaggaattggcaacagagattttacca
cataatccaactaaggttccagctgaaactttacaaaatattggtaaagtaatatcaaca
tggcctgaaaaattcgaagtacataaaaatttaaaaagaattttaacaaacagaggtaaa
tcgattagtgaaggtgaaggtattgattggtctactggtgaagccttggcttttgcaact
ttaactttggagggacataacgttagagtctccggtgaagatgttgaaagaggtacattt
tctcaacgtcatgcagttttacatgatcaaaattccgaagatacctatatcccattaaaa
catttaagtgaaaaacaagcagacttctcaatttgtaattcatccttatccgaatatggt
gttatgggatttgaatatggttattccttgacttctccagaatatttagtaatgtgggaa
gcccaatttggtgattttgccaacactgctcaagtgatcattgatcaatttattgctggt
ggcgaacaaaaatggaaacaaagatccgggttaatcttatctttaccacatggttatgat
ggtcaaggtccagaacattcatcaggtcgattagaaagatttttacaattagctaatgaa
gatccaagatatttcccatctgaggaaaaattacaaaggcaacatcaagattgtaacttc
caagttgtatacccaacaactccagctaacttattccatattataagaagacaacaacat
cgtcaattccgtaaacctctagcacttttcttctctaaacaattattacgtcatccatta
gctagatcgaatttagaagaatttacagaaggtggtttccaatggatcattgaagatgtg
gaacatggtaaggcaattggtaccaaagaagaaacaaagagattggtcttactaagtggt
caagtctacactgctttacataagaagagagaaactcttggtgataagactacagctttg
atgaaaatcgaagaattacatccattcccatttgcacaattaagagatgcaatcaactcc
tatccaaatctagaagaaattgtatggtgtcaagaagagccattgaatatgggctcctgg
tctttcgtatctcctagattaaagacaacattgaatgaaacgacatataaagactttact
gtcagatattgcggtaggaacccaagtggtgctgtggcggctggttctaaggctctacat
gctgcagaagaagaagctttcttaaaggatgtttttcaacaatag

DBGET integrated database retrieval system