KEGG   Naumovozyma dairenensis: NDAI_0B04160Help
Entry
NDAI_0B04160      CDS       T02234                                 

Gene name
NDAI0B04160
Definition
(RefSeq) hypothetical protein
  KO
K10967  alpha 1,2-mannosyltransferase [EC:2.4.1.-]
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    NDAI_0B04160 (NDAI0B04160)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ndi01003]
    NDAI_0B04160 (NDAI0B04160)
Enzymes [BR:ndi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     NDAI_0B04160 (NDAI0B04160)
Glycosyltransferases [BR:ndi01003]
 Glycan extension
  Yeast mannan chain
   NDAI_0B04160 (NDAI0B04160)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_15
Motif
Other DBs
NCBI-GeneID: 11498538
NCBI-ProteinID: XP_003668693
UniProt: G0W6N9
LinkDB All DBs
Position
2:1051193..1052386
Genome map
AA seq 397 aa AA seqDB search
MVKFSIPPGRENQFKKIGVFIIAILTIFIIFHGASSSSDSSGSTRRSMKQVSTSVKGQNG
YKYEKVSYPKYTGPKVKATFVTLARNSDLYSLLESIKSVEDRFNHKFQYDWVFLNDEEFS
DEFKNVTTAMVSGTTKYGLVPAEHWSFPPWIDQERAAKVRDEMRAKKIIYGDSISYRHMC
RFESGFFYRHPLMDDYDWYWRVEPDIKLHCDIDYDIFKFMADNGKKYGFTISIHEYMDTI
PTLWDTTKEFMKRHPEHVHKNNMMNFVSDDNGESYNSCHFWSNFEIASLDFWRGPAYTEY
FDYLDKAGGFFYERWGDAPVHSIAAALFLDRNEIHHFGDLGYFHAPFHQCPLDDSIRLGN
KCDCDPKEDFTWNGFSCGVKYYSVNHLKKPAGWQEHA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggttaaattctctatcccacctgggagagaaaatcaatttaaaaagattggtgtcttc
atcatcgccatcttaacaatcttcattattttccatggtgcatcttcatcaagtgatagt
tccggatccacaagacgttccatgaaacaagttagtacttctgtcaagggacaaaatgga
tacaaatatgaaaaagtttcatatccaaaatatactggtccaaaagtgaaagctactttt
gtcaccttagctcgtaatagtgatttatattctctcttagaatccatcaaatctgtcgaa
gatagattcaatcataaatttcaatacgattgggtctttttaaatgatgaagaattttct
gatgaatttaaaaatgttaccactgcaatggttagtggtaccactaaatatggtctcgtt
cctgctgaacattggtctttcccaccttggattgatcaagagagagctgctaaagttaga
gatgaaatgcgtgcaaagaagattatttatggtgattctatttcatataggcatatgtgt
agatttgaaagtgggtttttctatagacatccattaatggatgattatgattggtattgg
agagtggaacctgatattaaattacattgtgatattgattatgatatcttcaaatttatg
gctgataacggtaagaaatatgggtttactattagtattcatgaatatatggacactatt
ccaactttatgggataccacaaaggaattcatgaagagacatccagaacatgttcataag
aacaatatgatgaattttgttagtgatgataatggtgaatcttataattcatgtcatttc
tggtctaattttgaaattgcctcattagatttttggagaggccctgcttacacggaatat
tttgattatttggataaagcaggtggattcttttatgaaagatggggagatgctcctgta
cattccattgctgctgcattattcttggatcgtaatgaaattcatcattttggtgattta
ggttatttccatgcaccattccatcaatgtccactagatgattccattagattaggtaat
aaatgtgattgtgatccaaaggaagatttcacatggaatgggttttcatgtggtgtcaaa
tattattccgttaatcatttgaagaaacctgctggatggcaagaacatgcttag

DBGET integrated database retrieval system