KEGG   Naumovozyma dairenensis: NDAI_0B04360Help
Entry
NDAI_0B04360      CDS       T02234                                 

Gene name
NDAI0B04360
Definition
(RefSeq) hypothetical protein
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    NDAI_0B04360 (NDAI0B04360)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ndi03036]
    NDAI_0B04360 (NDAI0B04360)
Enzymes [BR:ndi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     NDAI_0B04360 (NDAI0B04360)
Chromosome and associated proteins [BR:ndi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     NDAI_0B04360 (NDAI0B04360)
   HMT complexes
    COMPASS/SET1 complex
     NDAI_0B04360 (NDAI0B04360)
    COMPASS/SET1 complex (yeast)
     NDAI_0B04360 (NDAI0B04360)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: N-SET SET_assoc SET Troponin
Motif
Other DBs
NCBI-GeneID: 11496192
NCBI-ProteinID: XP_003668713
UniProt: G0W6Q9
LinkDB All DBs
Position
2:1091754..1095071
Genome map
AA seq 1105 aa AA seqDB search
MSGYYGHSNPHHPPGPYRYRNNATNNRYQRPEPIRPTPAISRYQTDSEQSASRYNSINGN
GATQHRQSRYPPSQHHSHNTRYDQTRQPVDNQSYHPTNTSYARTLREGTTKPWVRSSSYS
KQESRYGNEKPLHTSSRLSNPLPKRTLSMTSKGDLRPKPELRYAEDPALNNKYHYFNPTL
KTLINKDEMHHWNAKKKFPQMGYITVQDPIQQKQVLVSRIPDIKSRDPRSTKEHGPSSHR
KLREELTLTSRVPFDKFSVGPPPICELVIYPADDTNITTIQDISIKNYFRKFGTISHFES
FSDPNSALPLHIYLIKYTSPNDKLNNLDLPGKSAYEAVKDFNKKECLILGHHFNVILNKG
KILQTIKDKTIDENLKKVNALNKDKLPATPTSKASLDSTIPDKPITSKWLDRRLPNDLVR
IVNNKACLFVPKTFLFFHGFRIEDFKYKLRRYRYSRVLNHATGIYIVFNDLKECQNCRNI
ESGKLTLLSRKLHAPIEIKFVLIPPVDTLPTRFGGFDRTSSVTNTSSKGTTTIVKTYNTR
TELLEATVQYILEDLSKAINIDIKRRLIGPTVFDTLNPSNYPALMEEKKLRERESKKAAI
EEAERKKKEEVKTQDFDIFKLYGGYSRSNLKKRRYSQVSSDNISSISSTNKKRLTKGIKP
MAHILNEDTGSKETTPTIELSQGVEGYDDIEELASSASSSEDENELLEEDEDIEMKSESE
LTSPEPIHGQKIAIEAATAEVEQEDIIPEWYKPSMAEYPETVFPESPAIFKKSIDILDFQ
EVIKDTEDISILQELLDANETKPTEEMKHAGCISEYAIWKYRENEKNLRLTNEWHLNLNE
VPFDVELTKGKGSFKAEGFRKIPDNLKACYLPHRRKLNQPLNTVNQHGSDRPTGNKFTPE
PSARREESNDPDASESVSIQEISSSRDNRASNRRFQQNIEAQRAAIGAESDLLSLNQLNK
RKKPVTFARSAIHNWGLYALEPIAAKEMIIEYVGESIRQAVAEMRERRYLKNGIGSSYLF
RVDENNVIDATKKGGIARFINHCCDPSCTAKIIKVGGRRRIVIYALRDIAANEELTYDYK
FEREIDAEERLPCHCGSVNCKGFLN
NT seq 3318 nt NT seq  +upstreamnt  +downstreamnt
atgtctggttattatggccattctaacccgcaccatcctcctgggccttatcgatataga
aataatgctactaacaataggtatcaacgtccggaacctataagacctactcccgcaatt
agtaggtaccaaactgattcagagcagagtgcttctcgatataatagcataaatggcaat
ggtgcaacacagcatcgccaatcacggtatccgccatcacagcatcatagtcataataca
agatatgaccaaactcgtcagcctgtagataatcagtcttatcatccaactaacacatca
tatgctcgaacattgagggaaggtaccactaagccatgggtgagatctagctcttactct
aaacaagagtctcgctatggtaatgaaaaaccattacatacatcttctagattgagcaac
cctctgccgaaacgcacgctttctatgacatctaaaggagatttgcgacccaaaccggaa
ctgcgatatgcagaagatccagcactgaacaataaatatcattatttcaatccaaccttg
aaaacattaattaacaaagatgaaatgcatcattggaatgcgaagaaaaaattcccccag
atgggatatattacagtccaagacccgatacaacaaaagcaagtacttgtatcaagaatc
cctgacataaagtcgcgagatccaagatccaccaaagagcatggtccatcatcgcatcga
aagttgagagaagaactgacacttacatcacgggttccattcgataagttttcagtaggt
ccaccaccaatttgtgagcttgtaatttatcctgctgatgacacaaatataactactatt
caagatatttcaatcaaaaattattttagaaaatttggtacaatttcccattttgagtca
tttagtgatccaaatagtgcgttaccattgcatatatatttgattaaatatacatctccc
aacgacaaacttaataatttagatctacctggaaaatcggcatatgaggcagtgaaggat
tttaataagaaagaatgccttatattaggacaccattttaacgttatattaaataagggt
aaaattcttcaaacgattaaggataaaaccatagatgagaatctcaaaaaagtgaatgct
ctgaataaagataaactacccgctactcccacatctaaggcttcattggattcaacgatt
cctgacaaaccaattacatcaaaatggcttgataggcggcttccaaatgatcttgtaagg
attgttaacaataaggcatgtctttttgtaccaaagactttcctctttttccacggcttt
aggatagaggattttaaatataaattgagaagatatagatattcaagagtgttgaatcat
gcaactgggatttatattgtgtttaatgatctgaaagaatgtcaaaattgtagaaatatt
gaatcgggtaagttgactttattatcaagaaaactccatgctccaattgagataaaattc
gttcttataccacctgttgataccttacctacaagattcggtgggtttgatcggacttcc
tccgttactaatacttcaagcaagggtacaaccactattgtaaaaacctataatacaaga
acagaattgttagaggcaacagtacaatatattttagaggatttatcgaaggcaattaat
attgatattaagagaagattgattgggccaactgtttttgatactttgaatccatcgaat
taccctgctttaatggaggaaaagaaattaagggaacgtgagagcaaaaaagctgctatt
gaagaagcagaaaggaagaagaaggaagaagtgaaaacgcaagattttgatatttttaaa
ttgtatggtggatattctagatcaaatttgaagaaaagacgttattcgcaagtgtcgtcc
gataacatctcatctatatcttctaccaataagaagagattgactaaaggtatcaagcca
atggcacacatacttaatgaagatacgggctcaaaagagactacacccactattgaactt
tctcaaggggttgaagggtatgatgatatcgaagaattagcatcatcagcttcatcaagt
gaagatgaaaatgaactactagaagaagatgaagatattgaaatgaagagtgaatctgaa
ttgactagtccagaacctatacacggccagaaaatagcgatagaagccgctactgctgag
gtcgagcaggaagatattatcccagaatggtataaaccatcaatggcagagtatcctgag
acagtctttcctgagtctccagcaatcttcaagaaaagtattgatattttggatttccaa
gaagttattaaagacacagaagacatatctatattgcaggagctcttagatgctaatgag
accaagccgacggaagaaatgaaacacgctggttgcatttcagaatatgccatatggaag
taccgtgaaaatgagaagaacttgcggttaactaatgagtggcacttgaatcttaatgaa
gttccatttgatgtagagttgacaaaaggaaagggatcatttaaagcagaaggattcagg
aagattccggataacttgaaggcatgttacttaccacatcgccgtaaactcaaccaacca
ttaaataccgtcaaccagcatggttctgatagaccaactggtaataaatttacacctgaa
ccatcagcaagacgggaagagtctaacgatcctgatgcgtctgaatcagtttcgatccaa
gaaatatcatcatctagagataacagagcatcgaatagaagatttcaacagaatatcgag
gcacaaagagcagcaattggtgcagaatcagatttattatcattgaatcaactgaataaa
cgtaagaaacctgtaacatttgccagatcggctatacataattggggtttgtatgcattg
gaaccgatcgctgctaaagagatgattattgaatacgttggtgaaagtattcgtcaagca
gttgctgagatgcgagaacgacgttatttgaaaaacggtataggttcaagttatttattt
agggttgatgaaaacaatgttattgacgcaacaaaaaagggtgggattgcaagatttatt
aatcattgttgtgatccaagttgtactgcgaaaattattaaagtaggtggcagaagaaga
attgtgatttatgcccttcgcgatattgctgctaatgaagaattaacctatgattataaa
tttgaaagggaaattgatgcagaggaaaggttgccttgccattgtgggtcggtaaattgt
aaaggattcttaaattag

DBGET integrated database retrieval system