KEGG   Naumovozyma dairenensis: NDAI_0C03810Help
Entry
NDAI_0C03810      CDS       T02234                                 

Gene name
NDAI0C03810
Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi00020  Citrate cycle (TCA cycle)
ndi00190  Oxidative phosphorylation
ndi01100  Metabolic pathways
ndi01110  Biosynthesis of secondary metabolites
ndi01130  Biosynthesis of antibiotics
ndi01200  Carbon metabolism
Module
ndi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ndi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ndi_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NDAI_0C03810 (NDAI0C03810)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NDAI_0C03810 (NDAI0C03810)
Enzymes [BR:ndi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NDAI_0C03810 (NDAI0C03810)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Thi4 Pyr_redox_2 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 11496474
NCBI-ProteinID: XP_003669284
UniProt: G0W8D0
LinkDB All DBs
Position
3:869132..871060
Genome map
AA seq 642 aa AA seqDB search
MLSLRTRVATLPIKRTLLLQKSFFSTTRSCKLATTTTDTTTPFDNKDYHIIDHEYDCVVV
GAGGAGLRAAFGLAEAGFKTACISKLFPTRSHTVAAQGGINAALGNMHPDDWKWHMYDTV
KGSDWLGDQDSIHYMTREAPHSIIELEHYGMPFSRTEEGKIYQRAFGGQTKEYGKGEQAY
RTCAVADRTGHAMLHTLYGQALRHDTHFFIEFFAMDLLTHNGEVVGVIAYNQEDGTIHRF
RAHKTVLATGGYGRAYFSCTSAHTCTGDGNAMVSRAGFPLQDLEFVQFHPSGIYGSGCLI
TEGARGEGGFLVNSEGERFMERYAPTAKDLACRDVVSRAITLEIREGRGVGNEKDHMFLQ
LNHLPPSVLKERLPGISETASIFAGVDVTKEPIPILPTVHYNMGGIPTKWNGEALTIDEE
TGEDKVIPGLMACGEAACVSVHGANRLGANSLLDLVVFGRAVAHTVADTLQPNTPHKPVP
ADIGKESIANLDKIRNANGSRTTAEIRMNMKKTMQKDVSVFRTQESLDEGVSNITAVDKT
FDDVKISDRSLIWNSDLVETLELQNLLTCATQTAVSAAARKESRGAHAREDYPDRDDENW
MKHTLSWQSKAGAPVELKYRNVISTTLDEAECPSVPPTVRSY
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgttatcactcaggacaagagtagctactctacctataaaaaggacccttcttctacaa
aaatcattcttctccaccacacgctcttgcaaactagctacaacaaccacagacacaaca
acacccttcgacaataaggactaccatataatcgatcacgaatatgactgtgtagtagta
ggagcaggtggtgccggtctaagagcagcattcggtctcgctgaagcaggtttcaaaaca
gcctgtatttcaaaactattccccactagatcccatacagtcgctgcacaaggtggtatc
aatgcggctctgggaaatatgcatccagatgattggaaatggcacatgtatgataccgtc
aagggctcagattggctaggtgatcaagattctattcattatatgactcgtgaagctcct
cattccattatagaattggaacattacggtatgccattctctagaacggaagaggggaaa
atttatcaaagagcttttggtggacaaactaaagagtatgggaagggtgaacaggcttat
agaacttgtgctgtagcggatagaactggtcatgctatgttgcatacattatatggacaa
gctttaagacatgatactcatttctttattgaattctttgcaatggatttgttgactcat
aatggtgaagtcgtcggagttattgcttataatcaggaagatgggactattcataggttt
agagctcataaaacagtactggctactggtgggtatggaagagcttatttctcttgtacc
tcggctcatacttgtactggggacggtaatgcaatggtttcaagagctggtttcccgtta
caagatttggaattcgttcaattccacccctcagggatttatggttctggttgtttgatc
actgaaggtgcacgtggtgaaggtgggttcttagttaattctgaaggtgagagatttatg
gaacgttatgctccaactgctaaagatttggcttgtagagatgttgtctcaagagccatt
acattagagattagagaaggaagaggtgtaggtaatgaaaaggatcatatgttcttacaa
ttgaatcatttacctccatctgtcttgaaggaaagattacctggtatttctgagactgct
tctattttcgctggcgtagatgttacaaaggagccaatcccaattttaccaactgttcat
tataatatgggtggtattccaacaaagtggaatggtgaagctttaactattgatgaagaa
actggtgaagataaagttattcctggtctaatggcttgtggtgaagctgcttgtgtctcc
gtccatggtgccaatagattgggagctaattcattattagatttagttgtcttcggtcgt
gctgtggctcatactgtcgctgatactttacaaccaaatacacctcataaacctgttcca
gctgatatcggtaaagaatctattgctaatttggataagattagaaacgctaatggttca
agaacaactgctgaaattagaatgaatatgaagaaaacaatgcaaaaggatgtgtctgtt
ttcagaacccaagagtctttagatgaaggtgtaagtaatataacagctgtcgataagaca
tttgatgatgtaaagatatccgataggtcattaatttggaactctgatttggttgaaacc
ttagaactacaaaacttgttaacctgtgccactcaaactgctgtatctgctgctgcaaga
aaagaatctcgtggtgctcatgctagagaagattatcctgatagagatgatgaaaactgg
atgaaacatacattatcatggcaatcaaaagcaggtgctcctgttgaattaaaatataga
aatgttatatcaactactctagatgaagctgaatgtccttctgttccgccaactgtcaga
tcttattag

DBGET integrated database retrieval system