KEGG   Naumovozyma dairenensis: NDAI_0C05260Help
Entry
NDAI_0C05260      CDS       T02234                                 

Gene name
NDAI0C05260
Definition
(RefSeq) hypothetical protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi00730  Thiamine metabolism
ndi00790  Folate biosynthesis
ndi01100  Metabolic pathways
Module
ndi_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    NDAI_0C05260 (NDAI0C05260)
   00790 Folate biosynthesis
    NDAI_0C05260 (NDAI0C05260)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ndi04147]
    NDAI_0C05260 (NDAI0C05260)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ndi00537]
    NDAI_0C05260 (NDAI0C05260)
Enzymes [BR:ndi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     NDAI_0C05260 (NDAI0C05260)
Exosome [BR:ndi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NDAI_0C05260 (NDAI0C05260)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ndi00537]
 Enzymes
  NDAI_0C05260 (NDAI0C05260)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sigma_reg_N
Motif
Other DBs
NCBI-GeneID: 11496318
NCBI-ProteinID: XP_003669428
UniProt: G0W8S4
LinkDB All DBs
Position
3:complement(1219267..1220940)
Genome map
AA seq 557 aa AA seqDB search
MLIKLTEENVSLIRNSPPRKNLRRPKRKAIISSITITIVAITIILFYGFNNNSSSSSSSF
PKHPNKKNVILFITDGMGPASLSLTRSYRQFIENLPINDTLTLDNHLIGSSRTRSSDSLI
TDSAAGATAFSCILKTKNNAVGVNDQYEPCGTLLEAAKLDGLMTGLVVTTRITDATPAAF
SAHSNSRFQEDLIALHQLGKHNNLGRVVDLMIGGGRSHFHGKDDGGVRIDGRNLIDEAIN
DGWNYIDDRETFDSLQLGKNVSFPLLALLAENDIPFDLDRNPEEYPSLQEQAITAVNALV
EATKDSDKGFFLMIEGSRIDHAGHENDPAAQVREVLAFDKAFQSVLELVDEMDTETIVLS
TSDHETGGLVTARQVTKTYPEYVWYPLYLQNAKHSGEFLKSKILSFEGTLDDKKLFIEKK
ILQDILQIDDYNNDDVNALAEMNNLDDIQYKLNDMVSFRAQIGWTTHGHSAVDVNIYGYA
NTKSSWYHILDHLQGNHENLEIGEFIRQYLNLDLKDVTKRIKNVKTKLYDLEKIQEIEET
DDEYHHLAHQILKAKQL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgcttattaaattaacagaagaaaatgtttctctgataagaaattcaccacccaggaag
aacttgagaagacccaaaaggaaggcaataatctcatccataaccatcacaatagtagca
ataacaattatcctattttatggcttcaacaacaactcatcttcctcttcctcctcattt
ccaaaacatcccaacaagaaaaatgtaatattattcataacagacggtatgggtccagca
tcattatccctcactagatcatacaggcaattcatagaaaacttaccaataaacgataca
ttaaccctcgacaatcatttaataggatcttccagaacaagatcctcagactcattaatc
accgattcagcagcaggtgccaccgcattcagttgtatcttaaagactaaaaacaacgct
gttggagtaaatgatcaatatgaaccatgtgggacccttttggaagctgctaaattggat
ggacttatgacggggttggtggtcactacgagaattactgatgcaactcctgctgcgttt
agtgctcattctaattcaaggtttcaagaagatttgattgcgttacatcaactggggaaa
cataataacttgggtagagtcgtggatttgatgattggtggtgggagatcacatttccat
ggtaaagatgatggtggtgttagaatcgatggtagaaatttgattgatgaagcaattaat
gatggttggaattatattgacgatagggagacatttgattctttgcaattaggtaaaaat
gttagtttcccattgttggctttattggcagaaaatgatattccatttgatttggataga
aatcctgaagaatatccttctttgcaagaacaagctattactgctgtgaatgctttggtt
gaagccacaaaggattctgataaggggttcttcttgatgatcgaaggttccagaattgat
catgctggtcatgaaaatgatccagctgcacaggttagagaagttctggctttcgataag
gcattccaaagcgtcttggaattagtagatgaaatggatacagagactatcgttttatct
acttctgaccacgaaactggtggattagtcaccgcaagacaagttacgaaaacttatcct
gaatatgtttggtatccactttatttacaaaacgcaaaacattctggtgaatttttaaaa
tctaaaattttatcatttgaaggtactttagatgataagaaattatttatcgaaaagaaa
atattacaagatattttacaaattgatgactataataatgatgacgttaacgcattggct
gaaatgaataacttagatgatattcaatataaattgaatgatatggtttcatttagagcc
caaattggttggactacccatggtcatagtgctgttgatgttaatatttatggctatgcc
aatacaaaatcttcttggtatcatatcctggatcatttgcaaggtaatcatgaaaatttg
gaaattggtgaattcataaggcaatatttgaatttagatttaaaagatgtcactaaacgt
attaaaaatgttaaaactaaattgtatgacttggaaaaaattcaagaaattgaagaaact
gacgatgaatatcaccatttggcacatcaaattttgaaagcaaagcaattgtaa

DBGET integrated database retrieval system