KEGG   Naumovozyma dairenensis: NDAI_0D00420Help
Entry
NDAI_0D00420      CDS       T02234                                 

Gene name
NDAI0D00420
Definition
(RefSeq) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi04146  Peroxisome
ndi04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    NDAI_0D00420 (NDAI0D00420)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    NDAI_0D00420 (NDAI0D00420)
Enzymes [BR:ndi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NDAI_0D00420 (NDAI0D00420)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 11494860
NCBI-ProteinID: XP_003669599
UniProt: G0W995
LinkDB All DBs
Position
4:87785..88252
Genome map
AA seq 155 aa AA seqDB search
MVKAVAVLNGTAGVSGVVHFEQKSESDPTLVSWEITGNSPDAMRGFHVHEFGDVSNGCVS
AGPHFNPFGQTHGAPTDKVRHVGDMGNVKTDSQGVAKGSLSDHMIKLIGPNSIIGRAVVI
HAGQDDLGKGGNEESLKTGNAGGRNACGVIGVANN
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaagcagtcgcagtattaaatggaacagcaggtgtctccggtgtagtccatttc
gaacaaaaatcagaatctgacccaactttagtatcatgggaaattacaggtaattccccg
gatgccatgcgtgggttccatgtccatgaattcggtgatgtgtctaatggatgcgtctct
gcaggtccacattttaacccatttggtcaaactcatggggcaccaactgataaagttaga
catgtaggtgatatgggtaacgttaagactgattcacaaggtgtagcaaagggttcttta
tctgatcacatgattaaattgattggaccaaactccatcattggtagagctgtggtcatt
catgcaggtcaagatgatttagggaaaggtggtaatgaagaatctttaaaaactggtaac
gctggtggtagaaacgcttgtggtgtcattggtgtagccaacaactaa

DBGET integrated database retrieval system