KEGG   Naumovozyma dairenensis: NDAI_0E01690
Entry
NDAI_0E01690      CDS       T02234                                 

Gene name
NDAI0E01690
Definition
(RefSeq) hypothetical protein
  KO
K12766  serine/threonine-protein kinase MDS1/RIM11 [EC:2.7.11.1]
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    NDAI_0E01690 (NDAI0E01690)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ndi01001]
    NDAI_0E01690 (NDAI0E01690)
Enzymes [BR:ndi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     NDAI_0E01690 (NDAI0E01690)
Protein kinases [BR:ndi01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   NDAI_0E01690 (NDAI0E01690)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Pkinase_fungal
Other DBs
NCBI-GeneID: 11498875
NCBI-ProteinID: XP_003670228
UniProt: G0WB65
LinkDB
Position
5:335849..337051
AA seq 400 aa
MSSQDNNTNFQDTIVRKQVYYGHVQHTVNNAKNDTNDNDKNNNNDNDNNDSNNTNDNNKN
PNEPITISFPTTEVIGKGSFGLVFCTTLRETNELVAIKKVLQDRRFKNRELEIMKLIQHP
NVINLKYYFYEKDLDDEVYLNLILDYMPQSLYQRLRHFVHQRQSMPRLEIKFYMYQMFKA
LNYLHNAKNVCHRDIKPQNVLVDPNSWNLKICDFGSAKQLKPTEPNVSYICSRYYRAPEL
IFGATNYTNQIDIWSSGCVMAELLLGQPMFPGESGIDQLVEIIKILGTPSKQEICAMNPN
YMEHQFPQIKPIPLAKVFKKEDELTVNFLIQTLKYDPLERFNALQCLCSPYFDELRYGEG
RIKEITNDLKLLEFIVDEELAHLNPNELDIIKNKLAIHPI
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgagctctcaagataataatactaactttcaagatacaatagtgcgcaaacaagtttat
tatggccatgtacaacatactgtaaataatgccaaaaatgatactaacgacaacgacaaa
aacaacaataatgataatgacaataacgacagcaacaatactaatgacaataacaaaaac
cctaatgaacctataacgatatcattcccaactactgaagtcattggtaaaggttcattt
ggtttagtcttttgtaccaccttaagggaaactaatgaattagttgccattaaaaaagtg
ttacaagatagaagatttaaaaatagagaattagaaataatgaaactaatacaacatcca
aacgttataaatttaaaatattatttctatgaaaaggatttagatgatgaagtttattta
aatcttatattagattatatgccacaatccttatatcaacgattacgtcatttcgttcac
caacgtcaatctatgccaagattagaaattaaattctacatgtatcaaatgtttaaagca
ttaaattatttacataatgctaaaaacgtttgtcatagagatatcaaaccacaaaacgtt
cttgtcgatccaaactcttggaatttaaaaatttgtgatttcggtagtgcaaaacaattg
aaacctacagaaccaaacgtttcatatatttgttcaagatattatagagctcctgaattg
atctttggtgccacaaattatacaaaccaaattgatatctggtcaagtggttgtgtgatg
gcagagttattactgggacaaccgatgttccccggtgaaagtggtatcgatcaattagtc
gaaatcattaaaattttaggtactccatcaaaacaagagatttgtgccatgaatccaaat
tatatggaacaccaattccctcagattaaaccaataccattggcaaaagtttttaaaaag
gaagatgaattgactgttaattttctaatacaaactttaaaatatgatccattagaacgg
tttaatgctctacaatgtctttgttcgccatattttgatgaattgagatatggtgaaggt
agaatcaaagaaatcacaaatgatttgaaacttttagaattcatcgttgacgaagaatta
gctcatttgaatccaaatgaactcgatatcatcaaaaataaattagcaatacatcctata
tga

DBGET integrated database retrieval system