KEGG   Naumovozyma dairenensis: NDAI_0F03810Help
Entry
NDAI_0F03810      CDS       T02234                                 

Gene name
NDAI0F03810
Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NDAI_0F03810 (NDAI0F03810)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ndi02000]
    NDAI_0F03810 (NDAI0F03810)
Enzymes [BR:ndi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     NDAI_0F03810 (NDAI0F03810)
Transporters [BR:ndi02000]
 Other Transporters
  Pores ion channels [TC:1]
   NDAI_0F03810 (NDAI0F03810)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 11497037
NCBI-ProteinID: XP_003670942
UniProt: G0WD38
LinkDB All DBs
Position
6:904816..906012
Genome map
AA seq 398 aa AA seqDB search
MSNLNDSGMIQNHNQVSNLSNALRQVNIGNSNTTTDQSNINLELSSESNNNNSNPSNNVN
NNIPTHRNYEQEQENRNYVQQQQQQQQEQDNRNYEQQGQINSQNIQQQENHHHTHNMNIQ
QHQNHHPGQQLQQPQAPFGDVEYSRITKFFQNQPMEGYTLFSHRSAPNGFKVAIVLSELG
LQYNTIFLDFNVGEHRAPEFVSMNPNARVPALIDHNMDNLSIWESGAILLHLVNKYYKET
GDPLLWSDDLADQAQINAWLFFQTSGHAPMIGQALHFSYFHSQKIPSAIERYTDEVRRVY
GVVEMALAERREAVVMEMDTDNAAAYSSGTTPLSQSRFFDYPIWLVGDKLTIADLAFVPW
NNVVDRIGINIKVEFPEVYKWTKHMMRRPAVVKALRGE
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatttaaatgattctggaatgatacaaaaccataatcaagtctccaatttgtca
aatgcattgcgtcaagtgaatataggaaacagtaatacgactactgatcaaagcaatata
aatttggagttatcatcagaaagtaataacaataatagcaatccaagtaataacgtgaat
aataatatcccaacccatcgaaattatgaacaagaacaagagaatcgaaattatgtgcaa
caacagcaacagcagcaacaagaacaagataatcgaaattatgaacaacaaggacaaata
aattcacaaaacatacaacaacaggaaaatcatcatcatactcataatatgaatatacaa
cagcatcaaaaccatcatccgggacaacaattacaacaacctcaagcaccattcggagat
gttgaatactcaagaatcacaaaatttttccaaaatcaaccaatggaaggttacacgttg
ttctctcatcgatctgccccaaatgggttcaaagttgctattgtgttaagtgaattagga
ctacaatacaatacaatttttttagatttcaatgttggagaacaccgagcaccagaattc
gtatcaatgaatcccaacgcaagagtccccgcattaattgatcataacatggataattta
tccatatgggagtcaggagccatcttattacatctagtaaataaatactataaagaaact
ggcgatccattactttggtctgatgatttagctgatcaagcacaaattaatgcttggtta
tttttccaaacttctggtcatgcccctatgattgggcaagctttacatttcagttacttc
cattcacaaaagatcccaagtgccattgaacgttatactgatgaagttagaagagtttat
ggcgtggtagagatggcattggctgaaagaagagaagcagtcgtcatggaaatggatact
gataatgctgctgcttattcttctggcacaactccattatcacaaagtagattcttcgat
tatcctatatggttagttggtgataaattaacaattgctgatttagccttcgtaccatgg
aataatgtcgtcgataggattggtataaatattaaagtcgaattcccggaagtttataaa
tggacaaaacatatgatgagaagacctgctgttgttaaagcactacgcggtgaataa

DBGET integrated database retrieval system