KEGG   Naumovozyma dairenensis: NDAI_0G00580Help
Entry
NDAI_0G00580      CDS       T02234                                 

Gene name
NDAI0G00580
Definition
(RefSeq) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi00500  Starch and sucrose metabolism
ndi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NDAI_0G00580 (NDAI0G00580)
Enzymes [BR:ndi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     NDAI_0G00580 (NDAI0G00580)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15 eRF1_2
Motif
Other DBs
NCBI-GeneID: 11497230
NCBI-ProteinID: XP_003671077
UniProt: G0WDH3
LinkDB All DBs
Position
7:127092..129050
Genome map
AA seq 652 aa AA seqDB search
MFPPRIMDNFSYRRYETNVTHRYPTNTLLPSTRSLRRKAFMTFFSLSLLFFLLYLKLSNV
DQEHNHQIDESFQQKKTNNITIYDFYKKPDLTTTISTNQKEFYKRINLRPTSPYSIPKEN
FSLWINEQSQLSFERILLNIADENHNDLMSKFNVTEGVIIASPSKSKPDYFYQWIRDGSI
CMNSLSSNLLIMSSHDVHQKEKVGINKTLSTTILKYLNNSYNLQRLDNPSGKSITINKDS
LTGLGEPKWYANNTAFNLHWGRPQNDGPALRTITVLNLLNHLASNNLKFEDLIKVSFSSS
SDNSNNNNNNNNNNNNNNKLPFVNDLEVFQKIVFWDLKFICLHWNDETYDLWEEIYGKHF
FTTIVQLSAVKKGLEFIRKQNNMDEYSQFEDLLQETYDKMLNFILSQDYFINSNKNHIVE
SPNFLDSRSGLDIAVILGSLYSHHNSLNDPEDNPISMSSLPFDIDDSGILNTLFGLVRSM
SMIYPINHQRVNLKIGVALGRYPEDVYDGVGFSEGNPWFLATSGAAELLYKLIWKNYKFE
KDLMIPLNSWDSQFWTLIFDGFNDIEHDGKTYQLVIPYKSPAFEQTMTLLFDLAESFLDK
LREHVSDHGDMSEQFNKFSGYLQGADHLTWSYSSFWNCYQIRLKAMKFLNYI
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgttccctcctaggataatggataatttttcatatagaagatatgaaaccaatgtaact
catcgatacccaactaatacactattaccttcaacaagatcattaagacgcaaggcattc
atgacatttttctccctttcattattatttttccttctttatctaaaactttctaatgtt
gatcaagaacataaccatcagattgatgaaagttttcaacaaaagaagacaaataatata
acaatttatgatttctataaaaaacctgatttaactactaccatttcaacgaaccaaaaa
gaattttataaaagaattaatttgagaccaacttcaccttattcaatccccaaagaaaat
ttctcattatggattaatgaacaaagtcaattatcattcgaaagaatattattgaatatt
gcggatgaaaatcataacgatttaatgtctaaatttaatgtaactgaaggcgtaataatt
gcatctccatctaaatcaaaacctgattatttttatcaatggattagagatggttcaatt
tgtatgaattccttatcttcaaatctattaataatgtcatcacatgacgttcatcaaaaa
gagaaagtaggaataaacaaaacgttatcaacaacaatattgaaatatctaaataattcc
tataatttacaaagattagataatccctcaggtaagagtattactattaataaagattca
ttgacaggattaggtgagccaaaatggtatgcaaataatacagcatttaatcttcattgg
ggtagaccacaaaatgatggacctgcattgagaacaataacagtcttaaaccttttaaat
catttagcatcaaataatttgaaatttgaagatttaatcaaagtatcattttcatcatca
tcagataatagcaataataataacaataacaataataataacaataataataataaatta
cccttcgttaatgatttagaggttttccaaaaaatagtcttttgggatttaaaatttatt
tgcttacattggaatgatgaaacttatgacctttgggaagaaatttatggtaaacatttc
tttacaacaattgttcaattatcggcagtgaaaaagggactagaattcattagaaaacaa
aataatatggatgaatattcccaatttgaagatttattacaagaaacttatgataaaatg
ttaaattttatcctgtcacaagattactttataaattcaaataaaaatcatatagtggaa
agtcccaattttttagattcaagatcaggattagatattgctgtcatattaggttcattg
tattctcatcataactctttgaatgatcctgaagataatccaatttcaatgtcttcatta
ccatttgatattgatgattctggtattttaaatacattatttggattagtcagatcaatg
tctatgatttatccaattaatcatcaaagagtaaatttgaaaataggtgttgccctgggg
agataccctgaagatgtttatgatggtgttggattttctgaaggtaatccatggttctta
gctacatcaggtgcagctgaattattgtataaattaatttggaaaaattataaatttgaa
aaagatttaatgataccattaaatagttgggattctcaattttggacattaatattcgat
ggatttaatgatattgaacacgatggtaaaacttatcaattagttattccatataaatct
ccagcatttgaacaaacaatgactttactatttgatttggcagaatcattcttagataaa
ttaagagaacatgttagtgatcatggtgatatgagtgaacaattcaataaattttcaggt
tatttacaaggagctgatcatttaacttggtcatatagttcattttggaattgttatcaa
ataaggttaaaagcaatgaaatttttaaattatatatag

DBGET integrated database retrieval system