KEGG   Naumovozyma dairenensis: NDAI_0G03040Help
Entry
NDAI_0G03040      CDS       T02234                                 

Gene name
NDAI0G03040
Definition
(RefSeq) hypothetical protein
  KO
K05692  actin beta/gamma 1
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi04145  Phagosome
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    NDAI_0G03040 (NDAI0G03040)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ndi03021]
    NDAI_0G03040 (NDAI0G03040)
   03019 Messenger RNA biogenesis [BR:ndi03019]
    NDAI_0G03040 (NDAI0G03040)
   03036 Chromosome and associated proteins [BR:ndi03036]
    NDAI_0G03040 (NDAI0G03040)
   03029 Mitochondrial biogenesis [BR:ndi03029]
    NDAI_0G03040 (NDAI0G03040)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ndi04812]
    NDAI_0G03040 (NDAI0G03040)
   04147 Exosome [BR:ndi04147]
    NDAI_0G03040 (NDAI0G03040)
Transcription machinery [BR:ndi03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     NDAI_0G03040 (NDAI0G03040)
Messenger RNA biogenesis [BR:ndi03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     NDAI_0G03040 (NDAI0G03040)
Chromosome and associated proteins [BR:ndi03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     NDAI_0G03040 (NDAI0G03040)
    NuA4 complex
     NDAI_0G03040 (NDAI0G03040)
  Chromatin remodeling factors
   BAF complex
    NDAI_0G03040 (NDAI0G03040)
   PBAF complex
    NDAI_0G03040 (NDAI0G03040)
   SWR1 complex
    NDAI_0G03040 (NDAI0G03040)
Mitochondrial biogenesis [BR:ndi03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    NDAI_0G03040 (NDAI0G03040)
Cytoskeleton proteins [BR:ndi04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     NDAI_0G03040 (NDAI0G03040)
Exosome [BR:ndi04147]
 Exosomal proteins
  Proteins found in most exosomes
   NDAI_0G03040 (NDAI0G03040)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 11495581
NCBI-ProteinID: XP_003671324
UniProt: G0WE70
LinkDB All DBs
Position
7:complement(join(708715..709832,710590..710599))
Genome map
AA seq 375 aa AA seqDB search
MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQS
KRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMT
QIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDL
AGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTASQSSSIEKSY
ELPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMS
GGSTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQ
EYDESGPSIVHHKCF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggattctgaagtcgctgctttagttattgataacggttccggtatgtgtaaagccggt
ttcgccggtgatgacgctccaagagctgtcttcccatccatcgttggtagaccaagacat
caaggtatcatggtcggtatgggtcaaaaggattcttacgtcggtgatgaagctcaatct
aaaagaggtatcttaactttacgttatccaattgaacacggtatcgtcacaaattgggat
gacatggaaaaaatctggcatcatactttctacaatgaattaagagtcgccccagaagaa
catcctgttcttttaactgaagctccaatgaacccaaaatctaacagagaaaaaatgact
caaatcatgtttgaaacttttaacgttccagctttctacgtctctattcaagccgtctta
tctttatactcctctggtagaactaccggtatcgtcttagattctggtgatggtgttact
cacgttgtcccaatttatgcaggtttctcattacctcacgctatcttaagaattgattta
gctggtagagatttgaccgattatttgatgaagatcttaagtgaacgtggttattcattc
tccactactgctgaaagagaaattgttcgtgacattaaagaaaaattatgttacgttgca
ttagattttgaacaagaaatgcaaactgcttctcaatcatcttccattgaaaaatcttac
gaattaccagatggtcaagttattaccattggtaatgaaagatttagagctccagaagct
ttattccatccatctgtcttaggtttggaatcatcaggtattgatcaaaccacctataat
tccatcatgaaatgtgatgtggacgttagaaaggaattatacggtaatattgtcatgtct
ggtgggtctactatgttcccaggtattgctgaaagaatgcaaaaggaaattactgcattg
gctccatcttcaatgaaagttaaaattatcgctcctcctgaaagaaaatactctgtttgg
attggtggttccattttggcttctttgactactttccaacaaatgtggatctcaaagcaa
gaatatgatgaaagtggtccttctatcgttcatcacaaatgtttctaa

DBGET integrated database retrieval system