KEGG   Naumovozyma dairenensis: NDAI_0I03320Help
Entry
NDAI_0I03320      CDS       T02234                                 

Gene name
NDAI0I03320
Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi00010  Glycolysis / Gluconeogenesis
ndi00051  Fructose and mannose metabolism
ndi00052  Galactose metabolism
ndi00500  Starch and sucrose metabolism
ndi00520  Amino sugar and nucleotide sugar metabolism
ndi01100  Metabolic pathways
ndi01110  Biosynthesis of secondary metabolites
ndi01130  Biosynthesis of antibiotics
ndi01200  Carbon metabolism
Module
ndi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ndi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NDAI_0I03320 (NDAI0I03320)
   00051 Fructose and mannose metabolism
    NDAI_0I03320 (NDAI0I03320)
   00052 Galactose metabolism
    NDAI_0I03320 (NDAI0I03320)
   00500 Starch and sucrose metabolism
    NDAI_0I03320 (NDAI0I03320)
   00520 Amino sugar and nucleotide sugar metabolism
    NDAI_0I03320 (NDAI0I03320)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    NDAI_0I03320 (NDAI0I03320)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ndi04131]
    NDAI_0I03320 (NDAI0I03320)
Enzymes [BR:ndi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     NDAI_0I03320 (NDAI0I03320)
Membrane trafficking [BR:ndi04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    NDAI_0I03320 (NDAI0I03320)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N YcgL
Motif
Other DBs
NCBI-GeneID: 11493990
NCBI-ProteinID: XP_003672143
UniProt: G0WGI9
LinkDB All DBs
Position
9:complement(778208..779668)
Genome map
AA seq 486 aa AA seqDB search
MVHLGPKKPPARKGSMADVPKELLEQLEELESVFHVSADQLKAVTKHFISELNKGLSKEG
GNIPMIPGWVVDYPTGKESGDYLAIDLGGTNLRVVLVKLGGDRTFDTTQSKYKIPEGMRT
TQDPDELFGFIADSLKEFVEEIFPEGVSKPLPLGFTFSFPASQSKINSGVLQRWTKGFDI
PNVEGHDVVPMLQKQLEARKIPINVVALINDTTGTLVASLYTDADAKMGVIFGTGINGAY
YENVADIPKLEGKLADDIPKDSPMAINCEYGSFDNEHVVLPRNKYDIKIDEDSPRPGQQA
FEKMSSGYYLGELVRLALIDLHDKGFILKGQDMTKLNTPYIMDTSYPARIEEDPFENLED
TDALLQKDLGISTTVQERKLIRRLCELVGIRAARLAVCGIAAIFQKRGYKSGHAACDGSV
YKLYPGFQQHAAEALRDIFDWTPAPIDQYPIILSPSEDGSGAGAAIIAAVTEKRLAAGKS
VGVIGA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggttcatttaggtccaaagaaaccacctgccagaaagggctccatggctgatgtccca
aaggagttattagaacaattagaagaattggaatctgtcttccacgtttccgctgatcaa
ttgaaagctgtcaccaagcatttcatcagtgaattaaataaaggtttatctaaagaaggt
ggtaacattccaatgattccaggttgggttgtcgattacccaactggtaaggaatctggt
gattacttggctatcgatttgggtggaactaacttgagagtcgtcttggttaaattaggt
ggtgatcgtactttcgatactactcaatctaaatataagattccagaaggtatgagaact
actcaagatccagatgaattgttcgggtttattgctgactctttgaaagaattcgttgaa
gaaatcttcccagaaggtgtctccaaaccattaccattaggtttcactttctcattccca
gcttctcaaagtaaaattaacagtggtgttttacaaagatggactaaaggtttcgatatt
ccaaatgtcgaaggtcatgatgtcgttccaatgttacaaaaacaattggaagctagaaaa
atcccaattaacgttgtcgctttaattaacgatactacaggtactttagttgcttcttta
tacactgatgctgatgctaagatgggtgtcattttcggtactggtattaatggtgcttat
tacgaaaatgtcgctgatattccaaaattggaaggaaaattggctgatgatattccaaag
gattctccaatggctatcaactgtgaatacggttccttcgataatgaacatgtcgtctta
ccaagaaacaagtacgatatcaagattgatgaagattctccaagaccaggtcaacaagct
ttcgaaaagatgtcctccggttactacctgggtgaattagttcgtttagctttaatcgat
ttacatgacaagggtttcatcttgaagggtcaagatatgactaaattgaacactccttat
atcatggatacttcttacccagctagaattgaagaagatccattcgaaaacttagaagac
actgatgctttgttacaaaaggatttgggtatcagcaccactgttcaagaacgtaaattg
atcagacgtttatgtgaattggttggtatcagagccgctagattagctgtttgtggtatt
gctgctattttccaaaagagaggttacaagtccggtcatgcagcttgtgatggttcagtc
tacaaattatatccaggtttccaacaacatgctgctgaagccttaagagatatttttgac
tggactccagctccaatcgatcaatatccaattatattgtctccaagtgaagatgggtca
ggtgccggtgccgctattattgccgctgtcactgaaaaaagattagctgccggtaaatct
gtaggtgtcattggtgcttag

DBGET integrated database retrieval system