KEGG   Naumovozyma dairenensis: NDAI_0J01050Help
Entry
NDAI_0J01050      CDS       T02234                                 

Gene name
NDAI0J01050
Definition
(RefSeq) hypothetical protein
Organism
ndi  Naumovozyma dairenensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dopey_N Ku
Motif
Other DBs
NCBI-GeneID: 11494177
NCBI-ProteinID: XP_003672240
UniProt: G0WGR9
LinkDB All DBs
Position
10:240897..246065
Genome map
AA seq 1722 aa AA seqDB search
MSLPLKPFTIDSHTKQLNSKQKKFHINVERALERFDSVTEWADYIASLGTLLKALQSWSP
KFQNVKYYIPTPYQVSRRLTSSLSPSLPAGVHQKTLEVYTFIFENIGQETLSAECNIWIP
GILPLMTYASMSVRSHVIELFANYIVCLPSLTLKLLVRPILASLFPAIDDESSEFLPLTM
KLIETLKTNLNDDSLFWQTTFLIISSNKDRRLGGLVWLTKKFPSLNAVPHLLKTKEEELR
NFETTFNDNAQSSTLNNADKKKQKDLTLSILLPAAKDLVSPESGLLIRGLIRCLDDDNDL
LLKRGLLDLLLQRLQLNSPVLTTLVSYNDRKLLIMSCCRTALNKDMSLNRRIWNWLLGPN
SSSINLNNSSTSLLEKVTSDKENGTVNQDSEDTYFAKYGLKPLIDGLNDLLTNEENTIIA
FKICLAMMDRWELGSLIIPTMFIRLLQAAQKFANDKKVSKAASTFFDAVETNTIWGQIFE
WITKTKDFDFLYYVISTYDISTDEEIIIRHLPLVLLATLSFPFVAPSDADKNNDNNASQL
FSNYELYSKLLEHIPERAFLPLSHSKLTEESQLDEETIIKKILKYYDTVSSPHKIVNPED
NLGEPDLPFATEDLTFLIVAQTKRLLISNLHKFKSVNKISDVFVSIIDKIPGDTYPKQTN
PEISINDSLVRAILDATKNYDPCDATYSIIGMVNIFSNYLNTKMSVLDSTKLLKRIMECI
WCNMKMPNTQSIAIKCLKSLERTVSSNYLSGSLSYCFVQEKDITQRLNVIDLLWTRMDDN
TSLIKHPLQLILDELCDTQNPYYLSVSKWISLVLSSHSSNRFYKVMSEYIFEFDFLVKGY
LTEMDDLDMFTYRLQTLTNVLKTNDNNVVKNFALELTNDITVDYWKNEDMSTYKNLILVC
LLHFLKIENNNHAKSIRSSLLLLDCLLDGTEKNFKDIVIFLLQLSSNYISGDKIETELIA
FSLLDIVSKVLKLSHKNGIKLDIFDDNATHLKYIDYLVTSVSTMKAPLVVASYINLLSES
IVYFDHSIFSMVLPLTSSIVQCVQRLFNSAKVSGDYYESISLLLGGLKELSEVSHGYLAA
DEREGSFTSAPSKTDFFQSVVSNVFSTDPSGASTRLQGERDVVLQCFRQVTLSCLDLWCW
AHDHTEMSKDAKNQDNVNYNAYKFKFKSKDLLEHLFYLEPSEVLETMINARDDNNIITLI
HVLDGNKPAMTAPYLFSGIVYRYNKTTSVKFSSASNIKASANKALRFESSLIQKLSGTRL
MNFLIQYVDTLDNAAIEEFYGDFIIFFKEIITNYSLYIPISVSITKFVSIIAEKIAKSQF
GEQKRIRKDLADTFIKYISYVFANFPQAIGNDKSFIDSVDNELMFKDIEFIIPRTEYIVN
ENRSGDKYNVVISTIVTQVLSAYLKPRTEIDIPNYVISLCSTVAAYGSKVKIWRNVVNDF
FQDDKKLIIIGQNRMWNDVIYEWSQYPDTKDRLMSDLLLSTESKKLGMTPTLITFNAWND
SEINSKCQSLLRITYLILISPVDAYLLNFQTLITCVCQYLVSKESKIKSRCWMLLRTMVL
RFSESHFNDYWSMITYCLQTNLQEFYELLQIQGDINSSDVLQICKSVDLMLTLNIEGFVA
TNEWLFIIDTINCIYKSNPFMALIDEISEFKDFNLAKIDDVELAKETETNIPLLTGVHSI
EKYTQLKNFFRNLSYFHYEAIYSLKPTDVGICEDDLLTDIFV
NT seq 5169 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgccgttgaaaccattcacgatcgattcacatacgaaacaattaaattctaaa
caaaagaagttccacataaacgtagaaagagccctggaaagattcgactcagtaacagaa
tgggctgattacattgcaagtcttgggactctattaaaggcattacaaagttggtcacca
aaatttcagaatgtgaaatactatattccaacaccatatcaagtaagtagaagactaaca
tcatcattatctcccagcttaccagcaggtgttcatcagaagactttagaggtctatact
tttatttttgaaaatataggtcaagaaacattatcagctgaatgtaatatttggatacca
ggtatcttaccgctaatgacgtatgcttcgatgtcggtaagatctcatgtcattgaactc
ttcgcgaactatatagtatgtttaccatcattaacattgaaattattagttagaccaata
ttagcaagtttgtttccagcaattgatgacgaaagtagtgaattcttaccattaactatg
aaactaattgaaactttaaaaacaaatttaaacgatgattcattattttggcaaactaca
tttttaattatatcttcgaataaagatagaagattaggtggattagtttggttaactaaa
aaattcccttcacttaatgctgttcctcatttgcttaagaccaaagaagaggaattgcga
aatttcgaaactacttttaatgacaatgcacaatcatcaaccttgaataatgcagataaa
aagaaacaaaaagacctaactttgtctatactactacctgctgctaaagatttggtttca
cctgaatctggattattgattcgagggttaattcgttgtcttgatgacgacaatgattta
ctattaaaaagaggattgttggatctcttattgcaacgattacaattaaattcacctgtg
ctgactactttagttagttataatgacagaaaactgttgataatgagttgttgtagaacc
gctttgaataaagatatgtccttaaataggaggatatggaattggttattaggtccgaat
tcgtcgagtatcaatttaaataatagctctaccagcctactggaaaaagtaacatctgac
aaggagaacggtactgtaaatcaagacagcgaagatacatactttgctaagtacggccta
aaacccttgattgacgggttaaatgatttgttaacgaatgaagaaaatacaataattgca
ttcaagatatgtcttgcaatgatggatagatgggaacttggatcattgataataccaaca
atgttcattagattattacaagcggcacaaaaatttgcaaatgataaaaaggtttccaaa
gcagcaagcacgttttttgatgctgtagaaacaaatactatatggggccaaatatttgaa
tggattactaaaacgaaagactttgatttcctctattatgttatctccacttatgacata
tcaacagatgaagaaatcataatacgccatttaccgttggttcttttagcaaccttatca
tttccattcgttgctccttctgatgctgataagaataatgacaataatgcctcacagctc
ttttcaaactatgaactatactcaaaactgctagagcatatccctgaaagagcattcctt
ccattaagtcattccaaattaactgaagaaagtcaactagatgaagaaactatcataaag
aagattttaaagtattatgataccgtttcaagccctcacaagatagttaacccggaggat
aatttaggcgaacccgatctaccatttgctacagaagacttaacgttcctaatagtggca
caaacaaagagattattaatatctaatctccacaagtttaaatccgttaataaaatctcc
gatgtatttgtttcaatcatagataaaatacctggagatacatatcctaagcagaccaat
ccggagatttctataaacgattctcttgtcagggctattttagatgctacaaaaaactat
gacccatgtgatgcaacctattcaattataggtatggtaaacattttcagtaattatctc
aatacaaagatgtctgtgctcgactccaccaaattattgaaacgaataatggaatgtata
tggtgtaatatgaagatgccaaatacacaatcgattgctatcaaatgtttgaaatctttg
gaaagaactgtctcatcaaattatcttagcggttccctatcatattgctttgtacaagaa
aaagacattacacaaagactaaatgtaatagacctactatggacaagaatggatgataat
acttccttaatcaaacatccgttacaattgatcttagatgaattatgcgatactcaaaac
ccatattatctgagtgtatcaaaatggatttccttagtattaagctctcattcatctaat
aggttttataaagttatgagtgaatatatctttgaatttgactttttagttaagggttat
ttaacagaaatggatgatttagatatgtttacatatcgccttcaaacactaacaaatgta
ttgaagactaacgataataatgtggtgaaaaattttgctctagagctaacgaatgatatt
acagtggattactggaaaaatgaagatatgtcaacttataaaaatttgatacttgtttgt
ctattacattttctgaaaattgaaaataataatcacgcaaagagtatcagaagttcgtta
ttgttattagattgtttattagatggtacagaaaagaatttcaaagatatagtcatattt
ttactgcaattatcctcaaactatatctctggtgataagattgaaactgaattaatagcg
ttttcattattagacatcgtctcaaaagtgttaaagttatctcataagaacgggataaaa
cttgatatattcgatgataatgcaactcatttgaaatatatcgattatttggtgacaagt
gtttctaccatgaaggcacccctagtggtggcgtcttatatcaatttactttctgaaagt
attgtttatttcgatcattccattttcagtatggtactaccattgacctcgtcgattgtt
caatgtgtgcagcgtttgtttaattcagctaaagtaagcggtgattattacgaatcaatc
tcgttattactaggcgggttaaaagaactaagtgaagtatcacatggatatttagcagcc
gatgaacgagaaggatcttttacaagtgcaccatcaaagacagattttttccaatctgta
gtatcgaatgttttctcgacagatccttcaggtgcctctaccagattacaaggagaaaga
gatgtagtcttgcaatgcttcagacaagtaacgctttcttgtttagatttatggtgctgg
gctcatgatcataccgaaatgtccaaagatgcaaaaaatcaagataatgtcaattataat
gcatataaatttaaattcaaatcaaaagatcttctggaacaccttttttatttagagcct
tcggaagttttggaaacaatgattaacgcacgggacgataacaacattattacgttgatt
cacgttctagatggtaacaaacctgccatgacagctccttatttattttcagggatcgtt
tacagatataataaaacaacatcagttaaattttcatcagcttccaatataaaagcaagc
gctaataaagcactcagattcgaatcatctttgattcaaaagctatcaggaacaagatta
atgaattttttgattcaatatgtagatacattggataatgcagctattgaagaattctac
ggtgattttatcatattcttcaaggagattataacgaattactctttatatattccaatt
tcagtatcaatcactaaatttgtctcaattattgctgaaaagattgcgaaatcgcaattt
ggagagcaaaagcgtattagaaaagatttagccgatacgtttatcaaatatatcagctac
gtatttgccaatttcccgcaggcaatcggtaatgataaaagcttcatcgattcagtggat
aatgaattaatgttcaaagatattgagttcataatacctagaactgagtatattgtcaat
gaaaatcgatctggtgataaatataatgttgttatttccaccattgtgacacaagtttta
tcagcttacttgaaacctagaacagaaatagatattcccaactatgttatttctttatgt
tctactgtcgcagcatacggtagtaaagtcaaaatctggcgtaacgttgtaaatgatttt
tttcaggatgacaagaagttgattataatagggcaaaatcgaatgtggaatgatgttatt
tatgagtggtcccaatatcctgataccaaagatagattgatgagtgatttgttattatca
acagaatctaagaagctcggtatgacacctaccctaatcacgtttaatgcatggaatgat
tctgaaatcaacagtaaatgtcaaagcttactaagaataacttatcttatcttaatttca
ccagttgatgcgtatttactaaatttccaaacgctaattacttgtgtttgtcaatattta
gtttccaaagaatcgaaaatcaaatctaggtgttggatgttgttaagaactatggtatta
agattttcagagtcacatttcaacgattattggtccatgataacatactgtttgcaaaca
aatcttcaggagttttatgaattattacagattcaaggagacatcaattcatctgatgtc
cttcaaatttgtaaatcagtagatttgatgttaactttaaatattgaaggctttgttgct
acaaatgaatggttatttattattgatacaatcaattgtatatataagagtaatccattt
atggcattaattgatgaaatttcagaatttaaagattttaatttagccaagattgatgat
gtagaattggcaaaggaaacggagacaaatataccattattaactggtgtacattccatt
gagaagtatactcaactcaaaaatttcttccgaaatttgagttatttccattatgaagct
atctatagtttgaaacctacggatgttggtatttgcgaggatgaccttttaactgatata
ttcgtctaa

DBGET integrated database retrieval system