KEGG   Naumovozyma dairenensis: NDAI_0J01060Help
Entry
NDAI_0J01060      CDS       T02234                                 

Gene name
NDAI0J01060
Definition
(RefSeq) hypothetical protein
  KO
K19589  release factor glutamine methyltransferase [EC:2.1.1.297]
Organism
ndi  Naumovozyma dairenensis
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ndi03012]
    NDAI_0J01060 (NDAI0J01060)
Enzymes [BR:ndi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.297  peptide chain release factor N5-glutamine methyltransferase
     NDAI_0J01060 (NDAI0J01060)
Translation factors [BR:ndi03012]
 Eukaryotic Type
  Release factors
   NDAI_0J01060 (NDAI0J01060)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS Methyltransf_23 Methyltransf_12 Methyltransf_33 DUF2431 rRNA_methylase
Motif
Other DBs
NCBI-GeneID: 11494178
NCBI-ProteinID: XP_003672241
UniProt: G0WGS0
LinkDB All DBs
Position
10:complement(246160..246867)
Genome map
AA seq 235 aa AA seqDB search
MLPTPYIKCDYDKVYEPSEDSFLLLDSLEKDLEYLAQKFKNKLALVCEIGPGSGIITTFM
IQNHIPTTNNNSVYYAFDINPWALEATLDTVKLNRAKDNDNNNAGSKSSLLEPVQVDLTS
SWRSNQIDLLVFNPPYVPSETIPTRPERKEELDTWVDLALEGGKDGMEITNRVLAQLDTI
LTPNGIAYILFCARNKPEEIIKSMKENGYSNWNIELVKNRKAGWEVLSVYRFSRC
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgctgccgaccccatacatcaagtgtgactatgataaagtgtatgaacccagtgaagat
agttttctgctattagattctctagaaaaagatctagagtatttagctcaaaagttcaaa
aataagttagccttggtatgtgagattggtccaggttcagggataattaccaccttcatg
attcaaaatcatataccgacaactaacaataattccgtttattatgccttcgatattaat
ccgtgggcacttgaagctacgttagatactgtgaaactaaatagggcaaaagataacgat
aataataatgctggcagtaaaagtagtctattagaacctgtacaagtggatctcacatcc
tcttggagaagcaatcaaatagatcttcttgtttttaacccaccatatgttccaagtgaa
actattccaactagacctgaaaggaaagaagagttagatacatgggtagatcttgcttta
gaaggtgggaaagatggtatggaaattacaaatcgtgtactggctcaactagatactata
cttactccgaatggtattgcttatatcttattttgtgccaggaataaacctgaagagatt
ataaaatcaatgaaagaaaatggttacagtaactggaatatagaattggtgaaaaatagg
aaagctggatgggaagtactgagcgtatatagattctcgagatgttaa

DBGET integrated database retrieval system