KEGG   Naumovozyma dairenensis: NDAI_0J01070Help
Entry
NDAI_0J01070      CDS       T02234                                 

Gene name
NDAI0J01070
Definition
(RefSeq) hypothetical protein
  KO
K12158  ubiquitin-like protein Nedd8
Organism
ndi  Naumovozyma dairenensis
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ndi04121]
    NDAI_0J01070 (NDAI0J01070)
Ubiquitin system [BR:ndi04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   NDAI_0J01070 (NDAI0J01070)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ubiquitin Rad60-SLD TBK1_ULD Ubiquitin_2 TUG-UBL1
Motif
Other DBs
NCBI-GeneID: 11494179
NCBI-ProteinID: XP_003672242
UniProt: G0WGS1
LinkDB All DBs
Position
10:join(247102..247250,247366..247450)
Genome map
AA seq 77 aa AA seqDB search
MIIKVKTLTGKEIPVEISGNEPVYRIKELLEEKEGIPPSQQRLIFQGKQIDDEQSVSSAN
LVDGMQLHLVLTLRGGC
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atgattattaaagtgaagacgttgacagggaaggaaatcccagttgaaatatccggaaat
gaaccagtttatagaattaaagaattattggaggaaaaagaaggcattcctccttcacaa
caaagacttatattccaagggaaacaaattgatgacgaacaatcggttagttctgccaat
ttggtagatggtatgcaattacatttagtgttgacattgagaggaggttgttaa

DBGET integrated database retrieval system