KEGG   Naumovozyma dairenensis: NDAI_0K00690Help
Entry
NDAI_0K00690      CDS       T02234                                 

Gene name
NDAI0K00690
Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi00250  Alanine, aspartate and glutamate metabolism
ndi00410  beta-Alanine metabolism
ndi00430  Taurine and hypotaurine metabolism
ndi00650  Butanoate metabolism
ndi01100  Metabolic pathways
ndi01110  Biosynthesis of secondary metabolites
Module
ndi_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NDAI_0K00690 (NDAI0K00690)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NDAI_0K00690 (NDAI0K00690)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NDAI_0K00690 (NDAI0K00690)
   00430 Taurine and hypotaurine metabolism
    NDAI_0K00690 (NDAI0K00690)
Enzymes [BR:ndi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     NDAI_0K00690 (NDAI0K00690)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC OKR_DC_1 Cnd1
Motif
Other DBs
NCBI-GeneID: 11497548
NCBI-ProteinID: XP_003672503
UniProt: G0WHJ9
LinkDB All DBs
Position
11:complement(147980..149740)
Genome map
AA seq 586 aa AA seqDB search
MLHSHSTRQKGVSPPASDRGPSEVDIPQFQRGPRQSIVGLEDVKLLSSNLQQMSYHGATT
NTFDESNNKYIIPNHGLPEQTAYDLIHNELTLDGNPHLNLASFVNTTTTQIANRLIMENI
DKNLADNDEYPQLIELTQRCISMLAKLWKSNPDMEPIGCATTGSSEAIMLGGLAMKKIWE
AKMKKAGKSVEKPNILMSSACQVALEKFARYFEVECRLIPVCKESKYCLDPRKLWDYVDE
NTIGCYVLLGTTYTGHLENVEEVADVLTEIEIQHPSWSNKEIPIHVDGASGGFIVPFSFE
ASHMKKFGLERWGFNNPRVVSINTSGHKFGLTTPGLGWALWKDQSYLPPELRFRLKYLGG
VEETFNLNFSRPGFQVVHQYYNFVSLGFTGYKNHFLKSLFVARTFAYSLLKSEKLQDYIE
VISGIHERISDDKVPDNVTDYWENPQDFKPGVPLIAFKLSKHFNEAYPEIPQAIISKLLR
TRGWIVPNYPLPNSSDDSSNWEVLRVVFRTEMKLDFAQLLIIDIENIITKLLSCYEKVEE
HAEQEKQTKEGKRQFIYDMLLTLASPESEEDEKLKERVTRNYRGTC
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgctacattctcattcaacaagacagaaaggcgtctcaccacctgcttctgaccgtggc
ccttctgaagtagatatcccacaattccaaagaggaccacgtcaaagtatagtaggatta
gaagatgtaaaattattatcttcaaacctacaacaaatgtcatatcatggtgccaccacc
aatacatttgatgaatccaacaacaaatacatcatccctaaccatggacttcccgaacaa
actgcatacgatttgatccataatgaattgactttggatggtaatcctcatttaaattta
gcaagtttcgttaacactacgacgacacaaattgcaaatagattaattatggaaaacatt
gataagaatttagctgataatgatgaatatccacaattgattgaattaactcaacgttgt
atttctatgttagcaaaattatggaaatcaaacccagatatggaacccattggatgtgct
actactggatctagtgaagctatcatgttaggtggtcttgctatgaagaaaatttgggaa
gctaagatgaaaaaggctgggaagagtgtagagaaacctaatattttaatgagttctgca
tgtcaagttgcgttggaaaaatttgctaggtattttgaagtggaatgcagattaattcct
gtttgtaaggaatctaagtattgtttggatccaagaaaattatgggattatgtagatgaa
aatactattggatgttatgttttattggggactacttatacgggacatttagagaatgtg
gaagaagttgctgatgtgttgactgagattgaaattcaacatccaagttggtctaataag
gaaattccaattcatgtagatggtgcatctggtggatttattgttccattttcatttgaa
gcaagtcatatgaaaaaatttggtttagaaagatgggggtttaataatcctcgtgttgtt
agtattaatacgagtggtcataagtttggtttgactacgccagggttaggttgggctctt
tggaaagatcaatcttatttaccacctgaattaagatttagattgaaatatcttggtgga
gtagaggaaacatttaatttaaatttctcaagacctggattccaagtagttcatcaatat
tataatttcgtttcattggggtttactgggtataagaatcattttttgaaatcattattt
gtcgcgagaacatttgcatattcgttattgaaaagtgaaaaattacaagattatattgaa
gttattagtggtattcatgaacgtatatctgatgataaggttccagataatgttactgat
tattgggaaaacccacaagattttaaaccgggggtaccattaattgcgtttaaattatcc
aagcatttcaatgaagcatatcctgagattccacaagctattatttccaagttattgaga
actcgcggttggattgttccgaattatccattaccaaattcatctgatgattcaagtaat
tgggaagtattaagagttgtatttagaactgaaatgaaattagatttcgctcaattgttg
attatagatattgagaatattattaccaaattgttatcatgttatgaaaaagttgaagag
catgctgaacaagaaaagcaaactaaagaaggcaaacgtcaattcatatatgatatgtta
ttaacgttagcctctccagaatcagaagaagatgagaaattgaaggaaagagtaacaaga
aattacagagggacatgttga

DBGET integrated database retrieval system