KEGG   Nocardioides dokdonensis: I601_0253Help
Entry
I601_0253         CDS       T04431                                 

Gene name
frdA
Definition
(GenBank) Fumarate reductase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ndk  Nocardioides dokdonensis
Pathway
ndk00020  Citrate cycle (TCA cycle)
ndk00190  Oxidative phosphorylation
ndk00650  Butanoate metabolism
ndk01100  Metabolic pathways
ndk01110  Biosynthesis of secondary metabolites
ndk01120  Microbial metabolism in diverse environments
ndk01130  Biosynthesis of antibiotics
ndk01200  Carbon metabolism
Module
ndk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ndk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ndk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    I601_0253 (frdA)
   00650 Butanoate metabolism
    I601_0253 (frdA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    I601_0253 (frdA)
Enzymes [BR:ndk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     I601_0253 (frdA)
    1.3.5.4  fumarate reductase (quinol)
     I601_0253 (frdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Pyr_redox_2 NAD_binding_8 HI0933_like FAD_binding_3 GIDA AP_endonuc_2_N Peripla_BP_4
Motif
Other DBs
NCBI-ProteinID: ANH36706
UniProt: A0A1A9GF57
LinkDB All DBs
Position
264154..266181
Genome map
AA seq 675 aa AA seqDB search
MASTADVSGLTELNGPPEQRSDDAHGYYTPAAQKLVDAKAPTGLIKDRWTTRKMDNRLVN
PANRRKLDVIIVGTGLAGGAAAATLGEAGYNVKSFCYQDSPRRAHSIAAQGGINAAKNYK
EDGDSTYRLFYDTVKGGDYRSRESNVYRLAEVSANIIDQCVAQGVPFARDYAGLLDNRSF
GGVQVSRTFYARGQTGQQLLIGAYQAMERQVAEGTVTQFTRHEMLEVIVVDGTARGIIAR
DLVTGEIETHLADVVVLASGGYGNVFYLSTNAMGSNVTASWRAHRKGAYMANPCYTQIHP
TCIPVSGDHQSKLTLMSESLRNDGRIWVPKNKEDCTKDPRDIPEEDRDYYLERIYPSFGN
LVPRDIASRQAKNMCDEGRGVGPMVGDFRRGVYLDFADAIARLGEDAVREKYDNLFDMYE
RITGENPYQVPMRIYPAVHYVMGGLWVDYDLQSNIPGLFVTGEANFSDHGANRLGASALM
QGLADGYFVLPNTIRDYLADGPFEQISESHPAVVEARTSVEERISKFLSIGGSRSADSFH
KELGNIMWEYCGMERSEEGLRKAIDMIRELKAEFWSDLKVLGTADSLNQSLEKAGRVIDF
IELGELMCIDALNRRESCGGHFRAESQTEDGEALRHDEEFAYVAAWEWGGDGGQPVLHKE
DLIYTAIEMKQRSYK
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggcatccaccgcagacgtcagcggcctgacggagctcaacggacctcccgagcagcgt
tccgacgacgcccacggctactacacgccggccgctcagaagctcgtcgacgcgaaggcc
cccaccggtctgatcaaggaccgctggaccacccgcaagatggacaaccggctggtcaac
ccggccaaccgccgcaagctcgacgtgatcatcgtcggcaccggcctggccggcggcgcc
gccgccgccacgctcggcgaggccggctacaacgtgaagtccttctgctaccaggactcc
ccgcgccgggcgcactcgatcgccgcccagggcggcatcaacgcggccaagaactacaag
gaggacggcgactccacctaccgcctcttctacgacacggtgaagggcggcgactaccgc
tcgcgggagtccaacgtctaccgcctcgccgaggtcagcgcgaacatcatcgaccagtgc
gtggcccagggcgtcccgttcgcccgcgactacgccggcctgctcgacaaccgctccttc
ggcggcgtccaggtctcgcgcaccttctacgcccggggccagaccggtcagcagctgctg
atcggggcctaccaggcgatggagcgccaggtcgcggagggcacggtcacccagttcacc
cgccacgagatgctcgaggtcatcgtcgtcgacggcacggcgcgcggcatcatcgcccgc
gacctggtcaccggcgagatcgagacccacctcgcggacgtcgtggtgctcgcctccggc
ggctacggcaacgtcttctacctctccaccaacgcgatgggctccaacgtcaccgcgtcg
tggcgtgcgcaccgcaagggcgcctacatggccaacccctgctacacgcagatccacccg
acctgcatccccgtctccggggaccaccagtcgaagctgacgctgatgtcggagtcgctg
cgcaacgacggtcgcatctgggtgccgaagaacaaggaagactgcaccaaggacccgcgc
gacatccccgaggaggaccgcgactactacctggagcgcatctacccctcgttcggcaac
ctggtgccccgcgacatcgcgtcgcgccaggccaagaacatgtgcgacgagggccgcggt
gtcggcccgatggtcggcgacttccgccggggcgtctacctcgacttcgccgacgcgatc
gcccgcctgggcgaggacgcggtgcgcgagaagtacgacaacctcttcgacatgtacgag
cggatcacgggtgagaacccctaccaggtcccgatgcggatctaccccgccgtgcactac
gtcatgggcggcctgtgggtcgactacgacctgcagtccaacatccccggcctgttcgtg
accggtgaggccaacttctccgaccacggcgccaaccgtctcggtgcctcggcgctgatg
cagggcctggccgacggctacttcgtgctgccgaacaccatccgcgactacctcgcggac
ggcccgttcgagcagatctccgagtcgcacccggccgtggtcgaggctcgcacgtcggtc
gaggagcggatctccaagttcctgtccatcggcggctcccgctccgcggactccttccac
aaggagctcggcaacatcatgtgggagtactgcggcatggagcgctccgaggaggggctg
cgcaaggccatcgacatgatccgcgagctcaaggccgagttctggagcgacctcaaggtg
ctcggcaccgccgactcgctcaaccagagcctcgagaaggccggccgcgtgatcgacttc
atcgagctcggcgagctgatgtgcatcgacgcgctgaaccgtcgcgagtcctgcggtggg
cacttccgtgccgagtcgcagacggaggacggcgaggcgctgcgccacgacgaggagttc
gcctacgtggcggcctgggagtggggcggcgacggcggccagccggtgctgcacaaggaa
gacctgatctacaccgccatcgagatgaagcagcggagctacaagtga

DBGET integrated database retrieval system