KEGG   Nocardioides dokdonensis: I601_0254Help
Entry
I601_0254         CDS       T04431                                 

Gene name
frdB
Definition
(GenBank) Fumarate reductase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ndk  Nocardioides dokdonensis
Pathway
ndk00020  Citrate cycle (TCA cycle)
ndk00190  Oxidative phosphorylation
ndk00650  Butanoate metabolism
ndk01100  Metabolic pathways
ndk01110  Biosynthesis of secondary metabolites
ndk01120  Microbial metabolism in diverse environments
ndk01130  Biosynthesis of antibiotics
ndk01200  Carbon metabolism
Module
ndk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ndk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ndk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    I601_0254 (frdB)
   00650 Butanoate metabolism
    I601_0254 (frdB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    I601_0254 (frdB)
Enzymes [BR:ndk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     I601_0254 (frdB)
    1.3.5.4  fumarate reductase (quinol)
     I601_0254 (frdB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_10 Fer4_17 Fer4_9 Fer4 Fer4_2 Fer4_6 Fer4_4 Fer4_18 Fer2 Fer4_3 Fer4_15 Fer4_22 Fer4_16 Fer4_13 Fer4_21
Motif
Other DBs
NCBI-ProteinID: ANH36707
UniProt: A0A1A9GEK7
LinkDB All DBs
Position
266178..266921
Genome map
AA seq 247 aa AA seqDB search
MNLTLKIWRQKDAQSAGAMQSYSVADISEDMSFLEMLDTLNEQLNEQGEEPIAFDHDCRE
GICGSCDLMIDGQAHGPEVTTTCQLHMRSFEDGQTITIEPWRANAFPVVKDLIVDRSAFD
RIIQAGGYVSVNTGSAPEANSVPAPRDKAMRAFNVATCIGCGACVAACPNGSASLFLGAK
ITHLGELPQGQPERMGRVASMVAQHDHEGFGGCTNIGECTGACPKEIPLDVISQLNKDLR
DSLRAGF
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
gtgaacctcaccctcaagatctggcgtcagaaggacgcccagtctgccggcgcgatgcag
tcgtactccgtcgccgacatctccgaggacatgtcgttcctcgagatgctcgacacgctc
aacgagcagctcaacgagcagggcgaggagccgatcgccttcgaccacgactgccgtgag
ggcatctgcggctcgtgcgacctgatgatcgacggccaggcacacggccccgaggtcacc
accacgtgccagctgcacatgcgctcgttcgaggacggccagacgatcaccatcgagccg
tggcgcgccaacgcgttcccggtcgtgaaggacctgatcgtcgaccgctcggcgttcgac
cggatcatccaggccggcggctacgtctcggtcaacaccggctccgcgccggaggccaac
tcggtgccggcaccgcgcgacaaggccatgcgcgccttcaacgtcgccacgtgcatcggt
tgcggcgcctgcgtcgcggcctgcccgaacggttcggcgtcgctgttcctcggcgccaag
atcacccacctcggtgagctgccgcagggtcagccggagcggatgggccgggtggccagc
atggtcgcgcagcacgaccacgagggcttcggcggctgcaccaacatcggtgagtgcacc
ggcgcctgccccaaggagatcccgctcgacgtgatctcccagctcaacaaggacctgcgc
gactcgctgcgcgccggcttctga

DBGET integrated database retrieval system