KEGG   Nocardioides dokdonensis: I601_0369Help
Entry
I601_0369         CDS       T04431                                 

Definition
(GenBank) Putative DNA ligase-like protein
Organism
ndk  Nocardioides dokdonensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ANH36821
UniProt: A0A1A9GH09
LinkDB All DBs
Position
387310..388431
Genome map
AA seq 373 aa AA seqDB search
MDLPVMPPVRPMLAKAVKTVPDPAKHGGLSFEPKWDGFRCLVFRDGDEVELTSRNTKPLT
RYFPELVVAALEQLPERCVLDGEVFVALPTPDGGQRLEFEVLQERIHPAASRVEMLSQKT
PAGFVAFDLLALGDESYVDRPFAERRAALEAALAHLSGGDGPCHLTRTTTDPAVAEQWLD
EFEGAGLDGVVAKPLGAAYVENARTMLKIKHERTADVVLAGMREHKTSTAERPLLGSMLL
GLWTDGEDGPVLQHIGVSASFTETRRAELWTELEPLACAIDEHPWARWHEGAIANPDRVP
GTQSRWSAGKDLSFVPLRPERVLEVKYDHMEGRRFRHTAHFKRWREDRDPASCGYDQLDD
VVGYDLGQVLGSD
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccgtgatgccgccggtgcgcccgatgctggccaaggccgtcaagaccgtg
cccgacccggcgaagcacggcgggctgtccttcgagccgaagtgggacgggttccgctgc
ctggtcttccgtgacggtgacgaggtggagctgaccagccgcaacaccaagccgctgacc
cgctacttccccgagctcgtcgtcgccgccctcgagcagctgcccgagcgctgcgtgctc
gacggggaggtcttcgtcgcgctgcccacgcccgacggcggccagcgcctggagttcgag
gtgctccaggagcggatccacccggccgcctcgcgggtcgagatgctctcgcagaagacg
cctgccgggttcgtggccttcgacctgctggccctcggtgacgagtcgtacgtcgaccgg
cccttcgcggagcgccgcgccgcactcgaagcggcgctggcccacctctccggcggcgac
ggcccctgccacctgacccgcaccaccaccgacccggccgtggccgagcagtggctcgac
gagttcgagggcgccgggctcgacggcgtcgtggccaagccgctcggggcggcgtacgtc
gagaacgcccggaccatgctgaagatcaagcacgagcgcaccgccgacgtggtgctggca
gggatgcgggagcacaagacctccaccgccgagcgaccgctgctgggcagcatgctgctc
ggcctgtggaccgacggcgaggacggcccggtgctgcagcacatcggggtcagcgccagc
ttcaccgagacgcgccgcgccgagctgtggaccgagctcgagccgctcgcctgcgccatc
gacgagcacccgtgggcgcgctggcacgagggcgccatcgccaaccccgaccgggtgccc
ggcacccagagccgctggagcgccggcaaggacctctccttcgtgccgctgcgccccgag
cgcgtgctcgaggtcaagtacgaccacatggagggacgccgtttccggcacaccgcgcac
ttcaagcgttggcgcgaggaccgcgacccggcgagctgtgggtacgaccagctcgacgac
gtggtgggctacgacctcggtcaggtgctggggtcggactag

DBGET integrated database retrieval system