KEGG   Nocardioides dokdonensis: I601_2208Help
Entry
I601_2208         CDS       T04431                                 

Definition
(GenBank) Putative DNA ligase-like protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ndk  Nocardioides dokdonensis
Pathway
ndk03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ndk00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    I601_2208
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ndk03400]
    I601_2208
Enzymes [BR:ndk01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     I601_2208
DNA repair and recombination proteins [BR:ndk03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     I601_2208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ANH38633
UniProt: A0A1A9GM09
LinkDB All DBs
Position
2298766..2299713
Genome map
AA seq 315 aa AA seqDB search
MPPPRPMLATKTDTVPVGADWSHEVKWDGVRILADRADRGAGGATRLWSRNANEVGVAWP
DVVDSAVGSRDLLVDGEVIVLNEAGVPDFRVLQERLHVRRARTAEHLAGTLPATFMVFDL
LRLDGTDLTALPLHERRARLADLDLGRWQVPPAYDDGAMLHAATHQQGLEGVVSKRLDSR
YTFERRSPHWLKLAHRHRRSYVVGGWRPQEGTSDRLAALLVGEPTPQGLAYRGRVGSGIG
ARTSRQLAELVAGLARGSSPFDDEVPGIDARGTHWVEPVLVVDVDTHGTGHARLRQPSYR
GLREDLVPADLPDQS
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgcccccgccgcgcccgatgctcgccaccaagaccgacaccgtgcccgtgggtgcggac
tggtcgcacgaggtgaagtgggacggcgtgcggatcctggccgaccgggctgatcggggc
gccggcggcgcgacgaggctgtggagccgcaacgccaacgaggtcggggtcgcctggccc
gacgtcgtcgacagcgccgtgggctcccgcgacctgctcgtcgacggcgaggtgatcgtg
ctcaacgaggccggtgtccccgacttccgggtcctccaggagcgcctgcacgtacgccgc
gcccgcaccgccgagcacctggccggcaccctgccggcgacgttcatggtcttcgacctg
ctgcgcctcgacggcaccgacctgaccgccctgccgctccacgagcggcgcgcccgcctc
gccgacctcgacctcgggcgctggcaggtgccgccggcgtacgacgacggggcgatgctg
cacgccgccacgcaccagcaggggctcgagggcgtggtcagcaagcggctcgactcccgc
tacaccttcgagcggcgcagcccgcactggctcaagctggcccaccggcaccgccgctcc
tacgtggtcggcgggtggcgtccccaggaggggaccagcgaccggctggccgccctgctg
gtgggggagccgaccccgcaggggctggcctaccggggtcgggtcggcagcggcatcggc
gcgcggacctcgcggcagctcgcggagctggtggcgggcctggcccggggttccagtccc
ttcgacgacgaggtgcccgggatcgatgcccggggcacgcactgggtcgagccggtgctg
gtcgtcgacgtcgacacccacggcaccggtcacgcacggctgcgccaaccgtcctaccgc
ggactgcgcgaggacctcgtccctgccgacctgccggaccagtcctga

DBGET integrated database retrieval system