KEGG   Nocardioides dokdonensis: I601_3226Help
Entry
I601_3226         CDS       T04431                                 

Definition
(GenBank) Universal stress protein
Organism
ndk  Nocardioides dokdonensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Usp
Motif
Other DBs
NCBI-ProteinID: ANH39633
UniProt: A0A1A9GPW0
LinkDB All DBs
Position
3385886..3386785
Genome map
AA seq 299 aa AA seqDB search
MEETNEAPVVVAVGDEDCEAALAFAGQEASRTGCGVHLLHVAPAFVHGSDSILVQSTDVE
EVGRRTLHLALEHARDVLPPSTAITSELLVGGIVDSLREATADAPMVVVQHRDLSRMRRL
VTRSVTNGLGAHARVPIVSVPSWWSPRRAPGQEPRVTVGVDVPVRSEQVLRTAVAAAQAR
GATLHALHAWKVAGIYDDITVARTLAEAWAERAGQEVRAALEALGPEAAGAPLVVETRHG
PAAEALVEASRSSDLLVVGRHDPMVPLGSHLGPVARGVLHESHCPVLLVDPHSRTHARP
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggaggagacgaacgaggcgccggtcgtggtggccgtcggtgacgaggactgcgaggcc
gccctggccttcgccggtcaggaggcgtcgcgcacgggctgtggggtgcacctgctccat
gtcgctccggccttcgtccacgggtccgacagcatcctggtccagtcgaccgacgtggag
gaggtcggacgccggacgctgcacctggcactcgagcacgcccgcgacgtgctgccaccc
agcacggcgatcacctcggagctgctcgtcggcgggatcgtcgactcgctgcgggaggcg
accgcagacgcccccatggtcgtcgtgcagcaccgtgacctgtcccggatgcgccgcctg
gtgacccgctcggtcaccaacggactgggcgcgcacgcccgggtgccgatcgtgtcggtg
ccgtcgtggtggtcaccccggcgcgcaccgggccaggaaccacgggtcaccgtgggcgtg
gacgtcccggtgcggtccgagcaggtgctgcgcaccgccgtcgcggctgcgcaggcccgc
ggcgcgaccctgcacgcgctgcacgcctggaaggtcgcggggatctacgacgacatcacc
gtggcccggacgctggccgaggcgtgggccgagcgtgcgggccaggaggtgcgggcggcg
ttggaggcgctcggtcccgaggcagccggcgccccgctcgtcgtcgagacccggcacggt
cccgcggccgaggcgctcgtggaggcgagccggtcgtcggacctcctggtggtcggtcgc
cacgacccgatggtcccgctgggctcccacctgggtccggtggcccgcggggtgctgcac
gagtcccactgcccggtcctcctggtcgacccccactcccgcacgcacgcccgcccctga

DBGET integrated database retrieval system