KEGG   Nocardioides dokdonensis: I601_3959Help
Entry
I601_3959         CDS       T04431                                 

Gene name
sodN
Definition
(GenBank) Superoxide dismutase [Ni] precursor
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
ndk  Nocardioides dokdonensis
Brite
KEGG Orthology (KO) [BR:ndk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    I601_3959 (sodN)
Enzymes [BR:ndk01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     I601_3959 (sodN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni DeoC
Motif
Other DBs
NCBI-ProteinID: ANH40356
UniProt: A0A1A9GQK7
LinkDB All DBs
Position
4177999..4178400
Genome map
AA seq 133 aa AA seqDB search
MFAKLFAPTVEVSAHCDLPCGVYDPAQARIEAESIKGIIAKVADNDDADFRTRAILIKEQ
RAEMVKHHLWVLWTDYFKPPHFEKYPQLHQLVNEATKLAGASGAKGLLDADVADQLLAKI
DEIAEIFWETKKA
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
ttgttcgccaagctcttcgcacccaccgtcgaggtgtccgcccactgcgacctcccgtgc
ggtgtctacgaccccgcccaggcccgcatcgaggccgagtcgatcaagggcatcatcgcc
aaggtcgccgacaacgacgacgctgacttccgcacccgcgccatcctcatcaaggagcag
cgcgccgagatggtcaagcaccacctgtgggtgctgtggaccgactacttcaagcccccg
cacttcgagaagtacccgcagctgcaccagctggtcaacgaggccaccaagctggccggc
gcctccggcgccaagggcctgctcgacgccgacgtggccgaccagctgctggccaagatc
gacgagatcgccgagatcttctgggagaccaagaaggcctga

DBGET integrated database retrieval system