KEGG   Nonlabens dokdonensis: DDD_1715Help
Entry
DDD_1715          CDS       T02441                                 

Gene name
kgd
Definition
(GenBank) 2-oxoglutarate dehydrogenase, dehydrogenase (E1) component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ndo  Nonlabens dokdonensis
Pathway
ndo00020  Citrate cycle (TCA cycle)
ndo00310  Lysine degradation
ndo00380  Tryptophan metabolism
ndo01100  Metabolic pathways
ndo01110  Biosynthesis of secondary metabolites
ndo01120  Microbial metabolism in diverse environments
ndo01130  Biosynthesis of antibiotics
ndo01200  Carbon metabolism
Module
ndo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ndo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ndo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DDD_1715 (kgd)
  Amino acid metabolism
   00310 Lysine degradation
    DDD_1715 (kgd)
   00380 Tryptophan metabolism
    DDD_1715 (kgd)
Enzymes [BR:ndo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     DDD_1715 (kgd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AGC76842
UniProt: L7W9F5
LinkDB All DBs
Position
1832228..1834987
Genome map
AA seq 919 aa AA seqDB search
MDKFSFLNAAHTAYFAQLYDEYLINPDKIEPSWRAFFQGFDFGMESATDGDVVVEYIERG
ESKSTQVPDQMMKEFSVVKLIDAYRSRGHLFTKTNPVRERRNYEPKLGLENFGLTNADLD
TLFDSGELIGLGKASLKSIIDHLEQVYCDSIGVEYMYIRKPHEIKWIQSWLHRNNNHPSF
SKEQKTQILKKLNEAVSFESFLHTKYVGQKRFSLEGNESLIPALDALIENAADKGVDQFI
LGMAHRGRLNVLTNIFGKPVKDIFSEFDGKDYEQDIFDGDVKYHLGYTSKRKTDNGNDIN
LNIVPNPSHLETVGAVVEGIARAKQDMHNPENFSKVLPIVLHGDAAIAGQGIVYEVVQMS
QLDAYKTAGTIHLVVNNQVGFTTNYLDARSSTYCTDVAKVTLSPVLHVNADDAEAVVHAM
NFALDYRMEFGRDVFIDLLGYRKYGHNEGDEPRFTQPQLYKAIGKHKNPRDIYADKLLQE
GLIDNSKVKELEAQYKERLEEELATSRQMENTIITPFMQDEWNGFEQATEVEMMQQVETG
VDRDTLEKITATISQLPEGESFIRKIKKIIESRQKMWDEDKLDWAMGEHLAYGSLMMEGY
NVRMSGQDVERGTFSHRHAVVKSENHENEFILHNHIDGVKGKMDIYNSHLSEYGVVGFEY
GYALARPNTLTIWEAQFGDFSNGAQIMMDQYISAGEDKWKNQNGLVKLLPHGYEGQGAEH
SSARIERYLQLCARDNMFMANCTTPANMFHLLRRQMLVNYRKPLVVFTPKSLLRYPKAVS
TISEFENGHFQEVIDVDGDAFAKAKTLVFTSGKFYYDLLEYREENKRTDVALVRLEQLFP
LPVEQMQEIIKKYGSKDIVWAQEEPRNMGAYSHLMLHMPETRSWRVCSRNMYAAPASGSS
TRSKRRQARIIEDVFNTNK
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atggacaaattttcatttctgaacgcagctcacactgcatacttcgcacaactttatgat
gaatacttaatcaatcctgacaaaatagagccgtcatggcgagccttttttcaaggtttt
gattttggaatggaaagcgccacagatggcgatgtggttgtagaatacatcgaaagaggc
gagtctaaatcaactcaagttccagatcaaatgatgaaggaatttagtgttgtaaaatta
attgatgcttatcgatcgcgtggtcatttgtttactaaaacaaatcccgtaagagaacgt
cgtaattatgaacctaaattaggactagagaactttggtcttactaatgctgatcttgat
acactgttcgactccggagaacttataggacttggaaaagctagtcttaaatctattatt
gaccatctagaacaagtttattgcgatagtatcggtgtagaatacatgtatatacgcaag
ccgcatgagatcaaatggatccagagctggttgcatagaaataataatcacccatctttt
tctaaagagcaaaaaactcaaatcctaaagaagcttaacgaagcggtttcttttgagtcg
ttcttgcatacaaaatatgtagggcagaaacgtttttctcttgaaggtaatgagtcactt
atccctgcattagacgcattgattgagaatgctgctgataaaggagtagatcagtttatt
ttaggaatggctcatcgtggtcgtcttaatgtactgactaatatttttgggaagcctgta
aaggatattttctcagaatttgatggcaaagattatgagcaggatatatttgatggtgat
gtaaaatatcatttaggttatacaagtaaaagaaaaacagataacggtaacgatattaac
ttaaacattgttcctaatccgtctcacttagaaacggtaggagcagtggtagaagggatt
gcacgtgcaaaacaagacatgcacaatcctgagaatttttccaaagtgctaccgatagtg
ttacacggtgatgcagcgattgctggacaaggaattgtttatgaggtggtgcaaatgtca
caacttgacgcttacaaaactgctggaacaattcacttagtagtaaataatcaagtaggt
ttcactactaactatcttgatgctagatcttccacttattgtacagatgttgcaaaagtg
acattgtctcccgtacttcatgtaaatgcagatgatgctgaagctgtagtgcatgccatg
aattttgcgctggattaccgtatggaatttggtcgtgatgtatttatcgatttactaggt
tatagaaagtatggtcataatgaaggtgatgaacctcgttttacacagccacaattatat
aaagcaataggaaagcataaaaatccgcgagatatttacgcagataaattgcttcaagaa
ggattgattgataatagtaaggtcaaagaattagaagctcaatacaaagagcgactagaa
gaagagcttgcaacatctagacagatggaaaataccattatcactcctttcatgcaagat
gagtggaatggttttgagcaagctactgaagtagaaatgatgcagcaggtggaaactggt
gtagatcgcgatactctagaaaagatcaccgctactatttcgcagcttccagaaggcgag
tccttcataaggaaaatcaaaaagattatcgagtcacgtcagaagatgtgggatgaggac
aagctagactgggcaatgggagaacaccttgcttacggtagtttaatgatggaaggctac
aatgtaagaatgagtggtcaagatgtagagcgagggactttttctcaccgccatgccgta
gtgaaatcagaaaatcatgaaaacgaattcattttacacaatcatatagatggtgtaaaa
ggtaaaatggatatttacaactcgcacttatcggagtatggagttgtaggatttgaatat
ggttatgctttggcacgacctaatacgctcaccatatgggaagctcaatttggagatttc
tcaaacggtgctcaaattatgatggaccagtacatcagtgctggagaagataaatggaag
aatcaaaacggtcttgtaaaattattaccacatgggtatgaagggcaaggagcagagcat
tctagtgcgcgtatagaacgttatttacaactttgtgctagagataatatgttcatggca
aactgtacaacgccggcaaatatgtttcatttattgcgccgtcagatgttagtaaactac
cgcaagccgctcgttgtttttactcctaagtctttgttacgttaccctaaagcggtaagc
acgatttcagaatttgagaatggtcattttcaggaagtaatagatgttgatggtgacgct
ttcgcgaaagcgaaaacactagtattcacctcaggtaaattctattatgatttactagaa
tacagagaagaaaataagcgcacagatgtggcactggtaagacttgaacaattgttcccg
ttaccagttgagcaaatgcaagaaattatcaaaaagtacggatcaaaagatatcgtatgg
gcacaagaagagcctagaaatatgggagcatattcccacttgatgttacacatgccagag
accagatcatggcgcgtgtgctctagaaatatgtatgcagcacctgcttcaggaagttcc
acaagatctaagagaagacaggcaagaataatagaagatgtttttaataccaacaaataa

DBGET integrated database retrieval system