KEGG   Nonlabens dokdonensis: DDD_3148Help
Entry
DDD_3148          CDS       T02441                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ndo  Nonlabens dokdonensis
Pathway
ndo00620  Pyruvate metabolism
ndo00680  Methane metabolism
ndo01100  Metabolic pathways
ndo01120  Microbial metabolism in diverse environments
ndo01200  Carbon metabolism
Module
ndo_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ndo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DDD_3148 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    DDD_3148 (ppc)
Enzymes [BR:ndo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DDD_3148 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 LuxQ-periplasm
Motif
Other DBs
NCBI-ProteinID: AGC78275
UniProt: L7W988
LinkDB All DBs
Position
complement(3392655..3395219)
Genome map
AA seq 854 aa AA seqDB search
MSRLTRIERFENEVKSKYQIFNGIFMTLPFDQISNTGGLLPLFHELCVRGYAKGKNPTEI
VEYFFERYMRDTDQQERESMLFRFIQYIERQVVLFDAIEDAAFGKVNNLDGRGSLRSVKD
EAVALGKTQELTSYLKEFKVRPVLTAHPTQFYPGSVLGILNDLGQAIKANEIQQVKLLLS
QLGKTPFFKKEKPTPFDEAISLIWYLENVFYFAMGNIYDYLKKHIEDAQEFKNQIVEIGF
WPGGDRDGNPFVTTEITLNVAKRLRSTIFRNYYRDIRKLRRRLTFKGVEEQLSKMESRCY
KAIFEKDVLDFTAQDLIDTMTSIRSMVIKEHNSLFLDQIDSFIHKIELFGFHFATLDIRQ
DSSAHDTVFDEILAFAKAELPSNYNDLSEVEKVNVLSKIEGTLRPDEFKEEYTQRTLSSI
YAIKDIQERNGEKGCNRYIISNTQMASQIMEVYAMIRLCGMKEPNIDVVPLFETVPDLIN
APDVMRKLYENEHYRAHLSRRGDKQDIMLGFSDGTKDGGYLMANWAIYKAKEALTRVSRE
YGVSIVFFDGRGGPPARGGGQTHQFYASMGTKIAAKEIQLTIQGQTISSKFGTLESCQFN
LEQMISSGVSNAVYASDINDFSDKDKSTMDELSEISYKAYTDFKAHPQFLSYLEKMSTLK
YYAKTNIGSRPSKRAGSTELRFKDLRAIPFVGSWSQLKQNVPGFYGVGTALEAMDKSGKW
NDALDLYKNNKFFRTLLDNSMMSLTKSFFGLTAYMEHDPVYGEFWKLIYEEYKRSKKYML
KISGMSALMENERAGQASIETRENIVLPLLTIQQYALKMVQDIRSEVVTKDIETYERMVT
RSLYGNINASRNSA
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagacttacaagaattgagcgctttgaaaatgaagtgaaatccaaatatcagatt
ttcaatgggatttttatgactttaccatttgatcaaatctcaaatactggtggattgtta
ccattgttccatgaattgtgtgtgcgtggttatgcaaaaggtaaaaaccctactgaaatc
gttgaatatttctttgaacgttacatgcgtgatacagaccagcaggaacgggagtccatg
ctttttaggtttattcagtatatagaacgtcaagtcgttttatttgatgcgatcgaggat
gcagcctttggaaaagtaaataatcttgacggccgcggttctttgcgtagtgtaaaagac
gaagccgtagctttaggtaaaacacaagaattaacgtcttatttaaaagaatttaaagta
agaccagtgttaacggcacacccaactcaattctatcctggatctgttttagggattctt
aatgacttaggtcaggcaataaaggcaaatgaaatccagcaagtgaagttgttgctttct
caattaggaaaaactccattctttaaaaaagagaaacctacaccatttgatgaggcgatt
agtttgatctggtatcttgaaaatgtcttctattttgcaatgggtaatatttatgactat
ttaaaaaaacatattgaagatgcacaagagtttaaaaaccaaattgttgaaataggtttt
tggcctggtggtgatcgagatggtaatccatttgtaacgacagaaatcacgcttaacgtt
gcaaaaagattgcgttctaccatttttagaaattattatcgggacatacgtaaactgcgt
agaagacttacttttaaaggagtagaagaacaactttctaaaatggagagcaggtgctat
aaagctatttttgaaaaagatgttttggattttactgcgcaagacttgatagataccatg
actagcatacgcagcatggtaattaaagagcacaattcgttgttcttagatcaaattgat
agttttattcataagattgaattgtttggttttcattttgcgaccttagacataagacaa
gacagtagtgctcatgacacggtttttgatgagattctcgctttcgcgaaagcggaatta
ccatctaactacaacgacttatcagaagttgagaaagtcaatgtactttctaaaatagaa
ggcactttgcgtccagatgaatttaaggaagaatacacgcagcgcactttgagtagcata
tatgccataaaggatattcaagaacgcaatggagaaaagggttgtaaccgctatatcatc
tctaacacgcaaatggcttctcaaataatggaagtttatgccatgatacgtttgtgcggt
atgaaggagcccaacatagatgtagttcctttatttgaaacggttcctgatttgatcaat
gcgccagacgttatgcgcaagttgtatgaaaatgaacattatagagcgcatttaagtcga
agaggagataagcaagacattatgttaggctttagtgatggaacaaaagatggtggttac
ttaatggctaattgggctatttacaaagccaaagaggcactaacaagagtttcacgagaa
tatggtgtttccatagtgttctttgatggtagaggtggaccaccagctagaggcggcgga
caaacacatcagttctatgcttctatgggaacaaaaatcgctgcaaaagaaatacaactc
actattcaaggacagacgataagctcaaaattcggaactttagaaagctgtcagttcaat
ctggagcaaatgataagtagtggcgtgagcaatgctgtatatgcaagtgatatcaatgat
ttctcagataaagataagtccacgatggacgaactttctgaaataagttacaaagcatat
actgattttaaggcgcatcctcaatttttgtcttatctagaaaaaatgagcacgttaaag
tattatgccaaaactaacataggaagccgccctagcaagcgagctggcagcacagagttg
cgatttaaggatttgagagcgattccgtttgtaggttcttggagtcaattgaaacaaaat
gttcctggtttctatggggtaggaactgctcttgaggcaatggacaaatctggaaaatgg
aatgatgctcttgacttatataagaataataagttcttccgtacattactggataatagc
atgatgagtctaactaagtcattctttggtttaactgcttatatggaacatgatcccgtt
tatggtgagttctggaaactgatttatgaagaatacaagcgttctaaaaagtacatgttg
aagatatctggaatgagtgcactaatggagaatgaacgagctggtcaagcgagtattgaa
acacgcgagaatatcgtattgccattgttaactatacagcaatatgcattaaaaatggtt
caggacatacgttctgaagtagttactaaagacatagaaacctatgagcgtatggtaacg
cgatcactttatggaaatatcaacgccagccgtaattctgcttaa

DBGET integrated database retrieval system