KEGG   Candidatus Nitrosotalea devanaterra: NDEV_1296Help
Entry
NDEV_1296         CDS       T04889                                 

Definition
(GenBank) Putative ATP-dependent DNA ligase
Organism
ndv  Candidatus Nitrosotalea devanaterra
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N
Motif
Other DBs
NCBI-ProteinID: CUR52061
UniProt: A0A128A3Y8
LinkDB All DBs
Position
1:complement(1135286..1135732)
Genome map
AA seq 148 aa AA seqDB search
MEDEPSESFCSDIVKKYDASQLERPVYVIQEHHASKLHWDLRFEMNNSLKSWALPKEPPQ
KIGERRLAISVDDHPIEYAMFEGQIPEGNYGAGKVKTWDKGTFDILENNEKKIIVNIHGA
RLRGKYCLVHFEQEEKNWLFFKMKYDSK
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
gtggaagatgaaccgtctgaatccttttgcagtgatattgtcaaaaaatatgatgcctct
caattggaacgacctgtctatgtaatccaggagcatcatgcctctaaactgcactgggat
cttagatttgaaatgaataactcgctgaagagctgggcattaccaaaggaaccacctcaa
aaaattggagaaaggcgtttggcaatatcagtcgacgatcacccaattgaatatgccatg
tttgagggacaaattccagagggaaattatggtgcaggcaaggtcaaaacttgggacaag
ggaacatttgacatcctagaaaataatgaaaaaaaaattatagtaaacatacatggtgct
agattgcggggaaaatattgtcttgtacactttgagcaagaagaaaagaactggctattt
tttaaaatgaaatatgattctaagtag

DBGET integrated database retrieval system