KEGG   Nostoc edaphicum: HUN01_20265
Entry
HUN01_20265       CDS       T07001                                 

Name
(GenBank) 2-oxo acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ned  Nostoc edaphicum
Pathway
ned00010  Glycolysis / Gluconeogenesis
ned00020  Citrate cycle (TCA cycle)
ned00620  Pyruvate metabolism
ned01100  Metabolic pathways
ned01110  Biosynthesis of secondary metabolites
ned01120  Microbial metabolism in diverse environments
ned01200  Carbon metabolism
Module
ned_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ned00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HUN01_20265
   00020 Citrate cycle (TCA cycle)
    HUN01_20265
   00620 Pyruvate metabolism
    HUN01_20265
Enzymes [BR:ned01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HUN01_20265
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase
Other DBs
NCBI-ProteinID: QMS89802
UniProt: A0A7D7QH02
LinkDB
Position
complement(4231391..4232689)
AA seq 432 aa
MSIHEVFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVETFYEGFLAHI
IVEAGETAPVGSAIAFIAETEAEIEQAKSLANSGGIAASATSSPEPIPVTASAATPALAS
QNGSNHKEGRLVVSPRARKLAKELKVDLTTLQGSGPHGRIVAEDVEALSNKGKQPAPAPV
APPAPVPTSAPSAPPATRTPAPAPVAAVPGQTVPLTTFQNAVVRNMVATISVPVFRVGYT
ITTDGLDKLYKQIKSKGVTMTALLAKAVAVTLQKHPLLNASYSDQGIVYHSDINISVAVA
MDDGGLITPVLQNADAVDIYSLSRTWKSLVERARAKQLQPQEYNSGTFTLSNLGMFGVDK
FDAILPPGQGSILAIGASRPQVVATPDGLFGVRQQMQVNITSDHRIIYGAHAAAFLQDLA
KLIETNPQSLTL
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgagcattcacgaagtatttatgccggctctgagttctaccatgaccgaaggcaaaatc
gtctcctgggtgaaatcgccaggtgacaaagtggaaaaaggcgaaacagtggtggttgta
gagtcagataaggcagatatggatgtagaaaccttctatgagggatttcttgcccatatc
atagttgaagctggtgaaactgccccggtaggatctgcgatcgccttcatagccgaaacg
gaagctgaaattgaacaggccaaatctcttgccaattccggcggcatagctgctagtgct
acctcatcccctgaaccaatccccgtcacagcctcagctgcaacacctgccttagcgtct
caaaacgggtctaaccacaaagaagggaggcttgtagtttcaccccgtgcccgcaagtta
gccaaagaactcaaagttgatttaactacactccaaggtagtggcccccacggtcgcatt
gtcgccgaggatgtagaagcattgtccaataagggcaagcaacccgcccctgccccagtt
gccccacccgcacctgtaccaaccagtgccccatctgcacccccagcaactcgcacacca
gcacccgcaccggtagcggctgttcctggtcaaaccgtgcctctaactaccttccaaaat
gccgtagtgcggaacatggtagccaccatatccgtgcccgttttccgtgtcggttataca
attaccaccgatggattagacaaactttataaacaaattaaatccaaaggtgtgacaatg
acagcgctactggcgaaagctgtagcggtaacattgcaaaaacatccacttttgaatgcc
agctactcagaccagggtattgtttatcattctgatatcaacatttccgtagcagtagcg
atggatgatggcggattaattacacctgtgctgcaaaatgcagacgcagtggatatttat
tctctatcgcgtacttggaagtctttggtagaacgtgcgagagcaaaacaattacagccc
caagaatataacagtggtacttttaccctgtcgaacttggggatgtttggcgtagacaag
tttgatgcgattttgccacctgggcaaggttcaattttagcgatcggggcatcccgtccg
caagtggtagcaacacctgacggtttatttggcgtgcggcaacaaatgcaagtcaatatt
acttctgaccaccgcattatttatggtgcccatgctgcggcgttcttgcaagatttagcg
aaattgattgagacaaatcctcaatctttgacactgtag

DBGET integrated database retrieval system