KEGG   Neokomagataea sp. Ha5: E3E11_00855
Entry
E3E11_00855       CDS       T06092                                 

Gene name
trxB
Definition
(GenBank) thioredoxin-disulfide reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
neh  Neokomagataea sp. Ha5
Pathway
neh00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:neh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    E3E11_00855 (trxB)
Enzymes [BR:neh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     E3E11_00855 (trxB)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 GIDA FAD_oxidored K_oxygenase Thi4 NAD_binding_7 NAD_binding_8 FAD_binding_3
Other DBs
NCBI-ProteinID: QDH14648
LinkDB
Position
201931..202944
AA seq 337 aa
MTTVHRTDLLIVGSGPAGYTAGIYAARAALKPLLVTGLQPGGQLTITQDIENYPGFAEPV
GGPWLMEQMRLQAEHMGTEIIYDLITQAELKNGPDAEGYFHLKGDSGTTYLARSVVIATG
ARAKWLETEAEKKFQGHGVSACATCDGFFYRGKDVAVVGGGNTAVEEALYLTHHAKNVHL
IHRRDSLKAEKILQERLKANPKIHIHWNREIDDIYGTVPQGSENAPEVVSGVKLRDTENP
AAAPEKLAVDGVFIAIGHIPNIGPFRDQVACDEEGYIQTIPGTACTSVTGIFAAGDIQDK
IYRQAVTAAGTGCMAALEAERYLAAANRKRKDASKNV
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgaccacggttcatcgtaccgatctgctgatcgtcggttccggcccggccggctacact
gccggtatctatgcggcacgtgccgccctcaagcccctgctggtgaccggtctgcaacca
ggaggccagttgaccataacccaggatattgagaattaccccggctttgccgagccggtg
ggcggaccgtggcttatggagcagatgcgccttcaggcagagcatatgggcaccgaaatc
atttatgacctcatcacgcaggctgagctgaaaaacggtccagacgctgaaggctatttt
catctcaaaggggattcagggacaacctacctggcccgttctgtcgttatcgccacaggt
gcacgcgccaaatggctggagacggaagccgaaaagaaatttcagggtcatggggtttcc
gcctgcgccacctgcgatgggtttttctatcgcggcaaggatgttgctgtcgtcggcggg
ggcaacaccgcagtcgaagaggccctctatctcacacatcatgccaagaacgttcacctc
attcaccgccgtgattcgctcaaggccgaaaagattctgcaggaacgcctaaaggccaat
ccgaaaatccatatccattggaatcgtgagatcgacgatatttatggaacagtgccgcaa
ggaagcgaaaatgcaccggaagtggtcagcggcgtaaagctgcgggatacggaaaatccc
gccgctgcccctgaaaagctggcggttgacggtgttttcatcgcgatcggtcacattccc
aatatcggtccgttccgcgaccaggtagcctgcgatgaagaaggctatattcagaccatt
cccggaacggcctgcacctccgtcacgggcatcttcgccgctggggatattcaggacaaa
atctaccgtcaggccgtcaccgcagccggtacgggatgcatggccgctctggaagccgaa
cgttatctggccgctgccaacaggaaaaggaaagacgcctccaaaaacgtctga

DBGET integrated database retrieval system