KEGG   Neokomagataea sp. Ha5: E3E11_02325
Entry
E3E11_02325       CDS       T06092                                 

Gene name
ubiM
Definition
(GenBank) 5-demethoxyubiquinol-8 5-hydroxylase UbiM
  KO
K18800  2-polyprenylphenol 6-hydroxylase [EC:1.14.13.240]
Organism
neh  Neokomagataea sp. Ha5
Pathway
neh00130  Ubiquinone and other terpenoid-quinone biosynthesis
neh01100  Metabolic pathways
neh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:neh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    E3E11_02325 (ubiM)
Enzymes [BR:neh01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.240  2-polyprenylphenol 6-hydroxylase
     E3E11_02325 (ubiM)
SSDB
Motif
Pfam: FAD_binding_3 FAD_binding_2 FAD_oxidored DAO Pyr_redox_2 HI0933_like Thi4 Lycopene_cycl NAD_binding_8 GIDA Pyr_redox_3 Trp_halogenase Pyr_redox
Other DBs
NCBI-ProteinID: QDH14884
LinkDB
Position
complement(533387..534658)
AA seq 423 aa
MTKSSPSSQAAPASTGNEFDIVIAGGGPAGLAAALSCARDGWRVCVVERAPESVLADPSF
DGREIALTHHTRHWMEKTGVWHEIPPDAVCPLRVARVESGDATESPLLFRAEDAGPEGGD
GPLGYLVANHHIRRALYRRVAATPEITLLCGRSVSGFTPRRQEVSIQLDEPAGIDGAAPG
KELKARLLVGADGRFSRVRDMAGIGAIVHDFGMDILVCRMRHHPSHEETALQWFDERQTI
ALLPVAPDGKPGSVSSLVLTLPPEEIARLKAASPEEFSAEITRRTHRRLGELSLESPRIT
YPLKAVYAHRFHGPRLALIGDAAVGMHPITAHGFNFGIKAQEFLADAISAGSGDPGAPRA
LAAFARRLRRETAPLFAATNAIAVAYTRDEAPFLLARKLGLRLADRLVPFKRRVTRMLMD
PQP
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgaccaagtcttccccgtcttcccaggctgcgcctgcctcaaccggcaatgagtttgat
atcgtgatagccggtggcggccctgccgggctggcagcggccctgtcctgcgcgcgcgat
ggctggcgggtctgcgtggtggagcgcgcgcctgaatccgtgctggctgatccctccttt
gacgggcgggaaatcgccctgacccaccacacccgtcactggatggagaagacaggcgtg
tggcacgagatcccgcctgacgccgtctgcccgctgcgcgtggcgcgcgtggaaagcggg
gacgccactgaatcgccgctgctcttcagggcggaagatgcagggccggaaggcggagac
gggccgctgggctatctggtcgccaaccaccatatccgccgcgctttgtatcgccgcgtt
gcagccacgcctgaaatcacgctgctctgcgggcgttcggtctcaggcttcacgccccgc
cgccaggaggtttccatccagcttgacgagccggcaggcattgacggagctgcgcccggc
aaagagctcaaggcgcgtctgctggtgggggccgacgggcgcttctcgcgggtgcgcgac
atggcggggatcggggcgatcgtgcatgatttcggcatggacatcctggtctgccgcatg
cgccaccacccttcccatgaagagacggcattgcagtggtttgatgaacgccagacgatc
gcccttctgccagtggctcctgacggcaagcccggctctgtctcttcgctcgtcctgacc
ctgccgcctgaggagatcgcgcgtctcaaggctgcctcgcccgaagaattctcagccgag
atcacccgccgcacgcaccggcggcttggtgagctcagcctggaaagcccgcgcatcacc
tatcccctcaaggccgtttacgcccaccgttttcatggcccccgcctggccctgatcggt
gatgcggccgtgggcatgcacccgatcacggcgcacgggttcaatttcggcatcaaggcg
caggaattccttgctgacgcgatcagcgccggctcgggcgatccaggcgccccgcgggcc
ctggctgcgttcgcgcgccgcctgcgccgcgaaacggccccgctttttgcagccaccaat
gccatcgccgtggcctatacgcgtgatgaagcgcccttcctgctggcccgcaagcttggc
ctgcgcctggctgaccgcttggtgcccttcaagcgccgcgtcacccggatgctgatggat
ccccagccctga

DBGET integrated database retrieval system