KEGG   Neokomagataea sp. Ha5: E3E11_03330Help
Entry
E3E11_03330       CDS       T06092                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
neh  Neokomagataea sp. Ha5
Pathway
neh00480  Glutathione metabolism
neh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:neh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    E3E11_03330
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:neh02000]
    E3E11_03330
Enzymes [BR:neh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     E3E11_03330
Transporters [BR:neh02000]
 Other transporters
  Pores ion channels [TC:1]
   E3E11_03330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_2 GST_C GST_C_3 GST_N_3
Motif
Other DBs
NCBI-ProteinID: QDH15060
LinkDB All DBs
Position
complement(763467..764093)
Genome map
AA seq 208 aa AA seqDB search
MAQTYKLYYAWGACSLASHIMLIEAEVPFTIEAVNLQTEKTASGRDYYEINPRGAVPALE
IIDEVLTQNDAILPYIGDLSDIPAFCPVQGSMRRARVDEAIGFCGDIHSAYAAFFTFGKV
KGEVGERAMAGLKKRMRQLEAWLPEGTYWLGPFTQADAYAAVLISWAPGVGLDMKDYPKA
QALKERVWARPSTKKALAQEEAQRNKAG
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggcacagacctacaaactctattacgcctggggggcctgttccctggcatcgcatatc
atgctgatcgaggctgaagtgcccttcaccattgaagcggtgaacctgcagacggaaaag
acggctagcggacgcgattattacgagatcaatccgcgtggcgccgtaccggctctggaa
atcattgatgaggtcctgacccagaatgatgccatcctgccctatatcggcgatctcagt
gacattcctgctttctgccccgtccaggggagcatgcgccgtgcccgcgttgatgaggcg
atcggcttctgtggcgacatccacagcgcctatgcggcgtttttcaccttcggcaaggtg
aagggggaagtgggtgaacgcgccatggccgggttgaagaagcgcatgcgccagcttgaa
gcctggctgcccgaaggcacgtattggctcggacccttcacgcaggctgatgcttatgcg
gctgtgctcatcagctgggctcccggtgtcgggctggacatgaaggactatcccaaagct
caggcccttaaggaacgtgtatgggcacgcccatccaccaaaaaagccctggcccaggaa
gaagcgcagcgaaacaaggctggctga

DBGET integrated database retrieval system